The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on aspen.cels.anl.gov
 The SEED


FIG search

Protein fig|208435.3.peg.547: Streptococcus agalactiae 2603V/R

This feature in The SEED Viewer

NCBI Taxonomy Id: 208435

Current Assignment: FIG01115240: hypothetical protein
Translate Function Assignments


Context on contig NC_004116 from base 557266 to 567731 (10466 bp)

Fid Start End Size
(nt)		   Gap Find
best
clusters		 Pins Fc-sc SS Ev Function Aliases
538 557266 557649 384 +           IS1381, transposase OrfA locus|SAG0542, protein_id|NP_687571.1, gi|22536720, geneID|1013345
539 557682 558071 390 + 32         Mobile element protein locus|SAG0543, protein_id|NP_687572.1, gi|22536721, geneID|1013346
540 558254 558601 348 + 182     4: 1 3 2 4   LSU ribosomal protein L19p gene_name|rplS, locus|SAG0544, protein_id|NP_687573.1, gi|22536722, geneID|1013347
rna.91 558712 558783 72 + 110         tRNA-Arg-CCT  
541 559905 558826 1080 - 42         Integrase locus|SAG0545, protein_id|NP_687574.1, gi|22536723, geneID|1013349
542 560092 559910 183 - 4         hypothetical protein  
543 560891 560334 558 - 241         hypothetical protein locus|SAG0547, protein_id|NP_687576.1, gi|22536725, geneID|1013351
544 561690 560893 798 - 1         Phage CI-like repressor locus|SAG0548, protein_id|NP_687577.1, gi|22536726, geneID|1013352
545 562051 562194 144 + 360         hypothetical protein locus|SAG0549, protein_id|NP_687578.1, gi|22536727, geneID|1013353
546 562415 562191 225 - -4         hypothetical protein locus|SAG0550, protein_id|NP_687579.1, gi|22536728, geneID|1013354
547 562474 562632 159 + 58         FIG01115240: hypothetical protein locus|SAG0551, protein_id|NP_687580.1, gi|22536729, geneID|1013355
548 562662 562850 189 + 29         hypothetical protein locus|SAG0552, protein_id|NP_687581.1, gi|22536730, geneID|1013356
549 563639 562833 807 - -18         hypothetical protein locus|SAG0553, protein_id|NP_687582.1, gi|22536731, geneID|1013357
550 563691 563882 192 + 51         prophage LambdaSa1, transcriptional regulator, Cro/CI family locus|SAG0554, protein_id|NP_687583.1, gi|22536732, geneID|1013358
551 563950 564699 750 + 67         Phage antirepressor protein locus|SAG0555, protein_id|NP_687584.1, gi|22536733, geneID|1013359
552 564711 564854 144 + 11         hypothetical protein locus|SAG0556, protein_id|NP_687585.1, gi|22536734, geneID|1013360
553 565004 565234 231 + 149         hypothetical protein locus|SAG0557, protein_id|NP_687586.1, gi|22536735, geneID|1013361
554 565372 565596 225 + 137         hypothetical protein locus|SAG0558, protein_id|NP_687587.1, gi|22536736, geneID|1013362
555 565607 566467 861 + 10         DNA replication protein dnaD locus|SAG0559, protein_id|NP_687588.1, gi|22536737, geneID|1013363
556 566448 566681 234 + -20         hypothetical protein locus|SAG0560, protein_id|NP_687589.1, gi|22536738, geneID|1013364
557 566678 566818 141 + -4         Phage protein locus|SAG0561, protein_id|NP_687590.1, gi|22536739, geneID|1013365
558 566829 567083 255 + 10         hypothetical protein - phage associated locus|SAG0562, protein_id|NP_687591.1, gi|22536740, geneID|1013366
559 567086 567247 162 + 2         hypothetical protein locus|SAG0563, protein_id|NP_687592.1, gi|22536741, geneID|1013367
560 567249 567731 483 + 1         hypothetical protein (phage associated) locus|SAG0564, protein_id|NP_687593.1, gi|22536742, geneID|1013368

Annotation History   /   View All Related Annotations Help on Annotations


  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|208435.3.peg.547 FIG01115240: hypothetical protein
MNWKKLMLGDLEHTFTSRDGKEKTSVEFEGGVLPALLVLGGITWLIAWLITK

MD5 = 4f5998180b5f2d073a29d613dc78c4ca


  DNA Sequence

>fig|208435.3.peg.547 FIG01115240: hypothetical protein
atgaattggaaaaaactaatgctaggcgatttagaacacacgtttactagtcgtgatggc
aaggaaaaaacaagcgttgaatttgaaggcggcgtattgccagcactgttagtgctaggt
ggtatcacttggctgatcgcttggcttattacaaaataa


  DNA with Flanking Sequence

>fig|208435.3.peg.547 FIG01115240: hypothetical protein
gaagccctctcccctaacggggtaagtttagtttagcacattggctgtatctccgcaaga
atgaaaggagagtagatgtggaagaatctatattgaactctaagcgctacacaaaacttg
tcgtagagacagaagatggcaaaaaaatagcagaagttactttgacggaagcaacccctg
ctgatggatacgtgattaggttaacccctaattatgactaacctttaggtgggaatggat
cgttaccatagctgttacgttcgcgaattcgtccatttttgccatggataataacttcac
tgctattgtttttagcgataccagtagcgatttcgacagcttcggcttgggttgttgtgt
gtttggtcgcacgactgttgcctgcaccttttatatcccaaccgccattagggttaggta
cgacatgttgatttttagccattagcttatcctcctttcgttaaggataagttgattata
acatttttaggaggtacaaaatgaattggaaaaaactaatgctaggcgatttagaacaca
cgtttactagtcgtgatggcaaggaaaaaacaagcgttgaatttgaaggcggcgtattgc
cagcactgttagtgctaggtggtatcacttggctgatcgcttggcttattacaaaataaa
aactcccatgagggagtaggaggaaggtatggagtttatttatttactaattataccatc
aatagtttcatttgttgtatctatcttttggtcaaaactagtcttcaaaaaagtagtaga
aattatgacaaaaatggatgttgatcaacaagagctgaatgaaacaatgagagctcaaat
tttagaagaaatcaaaacattacgaaacgtcaggtaaacaagtttttgaaaatctaacac
caaataaagtaagagttatcattcctagatttgttagtactcttttgttttgttctttta
attcactgttctttttagttataaagctattattaagaatgttgtaatattctttctcat
ctacgtgtgctttgtaattaatttgaattagtcctagtctttctaaattagttaatgatg
aactttgaatagctatatcattttgttctaaattatctacgaatacatgactagcaatat
gctctaacggcttatcttg


  Assignments for Essentially Identical Proteins

No essentially identical proteins found

  Links to Related Entries in Other Sites

This PEG has no links.
add a new link

  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key		 Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer

Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options
Tool Description
General Tools
Psi-Blast NCBI's psi-blast is used to locate distant similarities
Transmembrane Predictions
TMpred Tool for Predicting Transmembrane regions
TMHMM Prediction of transmembrane helices in proteins
Protein Signals for Gram negative bacteria
Gram negative PSORT Prediction of protein localization sites
Gram negative SignalP Predicts the presence and location of signal peptide cleavage sites
Protein Signals for Gram positive bacteria
Gram positive PSORT Prediction of protein localization sites
Gram positive SignalP Predicts the presence and location of signal peptide cleavage sites
Other useful tools
LipoP Prediction of lipoproteins and signal peptides in Gram negative bacteria
Radar Rapid Automatic Detection and Alignment of Repeats in protein sequences
PPSearch Search for protein motifs against all patterns stored in the PROSITE pattern database
Gram negative CELLO Subcellular localization predictor at National Chiao Tung University
Gram positive CELLO Subcellular localization predictor at National Chiao Tung University
ProDom A comprehensive set of protein domain families automatically generated from the SWISS-PROT and TrEMBL sequence databases
PDB An Information Portal to Biological Macromolecular Structures
For Specific Organisms
RNAFold The RNAfold web server will predict secondary structures of single stranded RNA or DNA sequences.

< Hide tool descriptions
FIG search