The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|208435.3.peg.540: Streptococcus agalactiae 2603V/R

This feature in The SEED Viewer

NCBI Taxonomy Id: 208435

Current Assignment: LSU ribosomal protein L19p
Translate Function Assignments



Context on contig NC_004116 from base 552547 to 563639 (11093 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
533 553482 552547 936 -       2: 4 2   3'-to-5' oligoribonuclease A, Bacillus type locus|SAG0537, protein_id|NP_687566.1, gi|22536715, geneID|1013340
534 553748 554770 1023 + 265     3: 7 5 6   Adenosine deaminase (EC 3.5.4.4) locus|SAG0538, protein_id|NP_687567.1, gi|22536716, geneID|1013341
535 554829 555272 444 + 58     1: 14   Flavodoxin locus|SAG0539, protein_id|NP_687568.1, gi|22536717, geneID|1013342
536 555349 555624 276 + 76     5: 12 13 16 1 11   Chorismate mutase I (EC 5.4.99.5) locus|SAG0540, protein_id|NP_687569.1, gi|22536718, geneID|1013343
537 555617 556813 1197 + -8     1: 3   EriC-type fluoride/proton exchange protein locus|SAG0541, protein_id|NP_687570.1, gi|22536719, geneID|1013344
538 557266 557649 384 + 452         IS1381, transposase OrfA locus|SAG0542, protein_id|NP_687571.1, gi|22536720, geneID|1013345
539 557682 558071 390 + 32         Mobile element protein locus|SAG0543, protein_id|NP_687572.1, gi|22536721, geneID|1013346
540 558254 558601 348 + 182     4: 15 10 8 9   LSU ribosomal protein L19p gene_name|rplS, locus|SAG0544, protein_id|NP_687573.1, gi|22536722, geneID|1013347
rna.91 558712 558783 72 + 110         tRNA-Arg-CCT  
541 559905 558826 1080 - 42         Integrase locus|SAG0545, protein_id|NP_687574.1, gi|22536723, geneID|1013349
542 560092 559910 183 - 4         hypothetical protein  
543 560891 560334 558 - 241         hypothetical protein locus|SAG0547, protein_id|NP_687576.1, gi|22536725, geneID|1013351
544 561690 560893 798 - 1         Phage CI-like repressor locus|SAG0548, protein_id|NP_687577.1, gi|22536726, geneID|1013352
545 562051 562194 144 + 360         hypothetical protein locus|SAG0549, protein_id|NP_687578.1, gi|22536727, geneID|1013353
546 562415 562191 225 - -4         hypothetical protein locus|SAG0550, protein_id|NP_687579.1, gi|22536728, geneID|1013354
547 562474 562632 159 + 58         FIG01115240: hypothetical protein locus|SAG0551, protein_id|NP_687580.1, gi|22536729, geneID|1013355
548 562662 562850 189 + 29         hypothetical protein locus|SAG0552, protein_id|NP_687581.1, gi|22536730, geneID|1013356
549 563639 562833 807 - -18         hypothetical protein locus|SAG0553, protein_id|NP_687582.1, gi|22536731, geneID|1013357

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
Ribospme_LSU_Symbiont vcrecy LSU ribosomal protein L19p
Ribosome_LSU_bacterial gjo LSU ribosomal protein L19p
Single-copy_ribosomal_proteins gjo LSU ribosomal protein L19p
PanGenomes_ForPhylogeny_Str Ravcheev_Dmitry_user LSU ribosomal protein L19p


  Protein Sequence

>fig|208435.3.peg.540 LSU ribosomal protein L19p
MNPLIQSLTEGQLRSDIPEFRAGDTVRVHAKVVEGTRERIQIFEGVVISRKGQGISEMYT
VRKISGGIGVERTFPIHTPRVDKIEVVRYGKVRRAKLYYLRALQGKAARIKEIRR

MD5 = 87b150829e3e4862eae1f312f77eca6a


  DNA Sequence

>fig|208435.3.peg.540 LSU ribosomal protein L19p
atgaatccattaattcaaagtttgacagaaggtcaacttcgttctgatatccctgagttc
cgtgctggtgatactgtacgtgttcacgctaaagttgtcgaaggtactcgcgaacgtatt
cagatctttgaaggtgttgttatctcacgtaaaggtcaaggaatctcagaaatgtacaca
gtacgtaaaatttctggtggtatcggtgtagagcgtacattcccaattcacactcctcgt
gttgataaaatcgaagttgttcgttatggtaaagtacgtcgtgctaaactttactactta
cgcgcattgcaaggtaaagctgcacgtattaaagaaatccgtcgttaa


  DNA with Flanking Sequence

>fig|208435.3.peg.540 LSU ribosomal protein L19p
gatatgaagttgttcaaaatgagtcgcagaaacatcggacaagctgctaaaatcttggca
gacagtggttatcaagggatcatgaagatgtattcacaagcgcaaactccgaggaaatca
agcaaacttaagccactaactcttgaagataaaacctataaccatacgctatccaaagag
agaatcaaggttgagaatatttttgccaaagtaaaaacgtttaaaatattttcaacaacc
tatcgaaatcgacgcaaacggtttggattacgaatgaatttgattgctggaatgatcaac
cgtgaactaggattttagtttcgcaggaagtctaatatacaaataactattctaaaggat
gacaccttgttcttctagataaaatagctttacaagtaggttaaaatttggtagaattgt
gagagtgtgtgatggacgcacaaaaaacggctaatccgctgagacaagtacttaagatta
gtaagagaaggagaataaaaatgaatccattaattcaaagtttgacagaaggtcaacttc
gttctgatatccctgagttccgtgctggtgatactgtacgtgttcacgctaaagttgtcg
aaggtactcgcgaacgtattcagatctttgaaggtgttgttatctcacgtaaaggtcaag
gaatctcagaaatgtacacagtacgtaaaatttctggtggtatcggtgtagagcgtacat
tcccaattcacactcctcgtgttgataaaatcgaagttgttcgttatggtaaagtacgtc
gtgctaaactttactacttacgcgcattgcaaggtaaagctgcacgtattaaagaaatcc
gtcgttaattttgatgatcagattttaaaaatgcttggttgtttgaggatagtaactatg
ttttaaaactggacaaccaagacgtaaaaaatctgcctgtgggcagtttttttactaggt
ccccttagttcaatggatataacaactccctcctaaggagtaattgctggttcgattccg
gcaggggacatgtaaataacgtcaaaagcctttgtattaaaggctttttgttttattccg
attttaaaaggggcacaaaaggggcagtttgtttatttataatttctttcatatttacag
ttgtgtgactgtaaatagataatgttgtttttggatcgctgtgaccaactctatccatta
tcgcatttagcggtatccctttttctgctaaaaatgatatatgcgagtgtctaaataagt
gcgtgtgataatctccataaattttcaatcgcttattgatgtacgcgtttaaaatcggta
caccgttcgaatttggaaagacgaatga


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0003735       F:structural constituent of ribosome
GO:0005840       C:ribosome
GO:0006412       P:translation
cmr|NT04SA0695 Streptococcus agalactiae NEM316     ribosomal protein L19
cmr|SAG_0544 Streptococcus agalactiae 2603V/R     ribosomal protein L19
cmr|SAI_0670 Streptococcus agalactiae H36B     ribosomal protein L19
cmr|SAJ_0660 Streptococcus agalactiae 18RS21     ribosomal protein L19
cmr|SAK_0692 Streptococcus agalactiae A909     ribosomal protein L19
cmr|SAL_0610 Streptococcus agalactiae 515     ribosomal protein L19
cmr|SAM_0573 Streptococcus agalactiae CJB111     ribosomal protein L19
cmr|SAN_0649 Streptococcus agalactiae COH1     ribosomal protein L19
emb|CAD46231.1 Streptococcus agalactiae NEM316 EMBL   ribosomal protein L19
emb|CAR41494.1 Streptococcus uberis 0140J EMBL   50S ribosomal protein L19
fig|205921.3.peg.734 Streptococcus agalactiae A909 FIG   LSU ribosomal protein L19p
fig|205921.4.peg.622 Streptococcus agalactiae A909 FIG   LSU ribosomal protein L19p
fig|208435.1.peg.537 Streptococcus agalactiae 2603V/R FIG   LSU ribosomal protein L19p
fig|211110.1.peg.581 Streptococcus agalactiae NEM316 FIG   LSU ribosomal protein L19p
fig|211110.3.peg.603 Streptococcus agalactiae NEM316 FIG   LSU ribosomal protein L19p
fig|218495.3.peg.571 Streptococcus uberis 0140J FIG   LSU ribosomal protein L19p
fig|218495.5.peg.613 Streptococcus uberis 0140J FIG   LSU ribosomal protein L19p
fig|342613.5.peg.751 Streptococcus agalactiae 18RS21 FIG   LSU ribosomal protein L19p
fig|342614.4.peg.1454 Streptococcus agalactiae 515 FIG   LSU ribosomal protein L19p
fig|342615.4.peg.1747 Streptococcus agalactiae H36B FIG   LSU ribosomal protein L19p
fig|342616.4.peg.832 Streptococcus agalactiae COH1 FIG   LSU ribosomal protein L19p
fig|342617.4.peg.643 Streptococcus agalactiae CJB111 FIG   LSU ribosomal protein L19p
gb|AAM99445.1 Streptococcus agalactiae 2603V/R     ribosomal protein L19
gb|ABA46136.1 Streptococcus agalactiae A909     ribosomal protein L19
gb|AE014216_21 Streptococcus agalactiae 2603V/R     ribosomal protein L19
gb|EAO62780.1 Streptococcus agalactiae 18RS21     ribosomal protein L19
gb|EAO70761.1 Streptococcus agalactiae 515     ribosomal protein L19
gb|EAO73809.1 Streptococcus agalactiae CJB111     ribosomal protein L19
gb|EAO76010.1 Streptococcus agalactiae COH1     ribosomal protein L19
gb|EAO77462.1 Streptococcus agalactiae H36B     ribosomal protein L19
gi|222113621 Streptococcus uberis 0140J NCBI   50S ribosomal protein L19
gi|222152808 Streptococcus uberis 0140J NCBI   50S ribosomal protein L19
gi|22533564 Streptococcus agalactiae 2603V/R NCBI   ribosomal protein L19
gi|22536722 Streptococcus agalactiae 2603V/R NCBI   50S ribosomal protein L19
gi|23095010 Streptococcus agalactiae NEM316 NCBI   ribosomal protein L19
gi|25010656 Streptococcus agalactiae NEM316 NCBI   50S ribosomal protein L19
gi|254799807 organism not parsed/found in ncbi nr NCBI   RecName: Full=50S ribosomal protein L19
gi|39931964 organism not parsed/found in ncbi nr NCBI   RecName: Full=50S ribosomal protein L19
gi|39931968 organism not parsed/found in ncbi nr NCBI   RecName: Full=50S ribosomal protein L19
gi|76563552 Streptococcus agalactiae A909 NCBI   ribosomal protein L19
gi|76586264 Streptococcus agalactiae 18RS21 NCBI   ribosomal protein L19
gi|76788495 Streptococcus agalactiae A909 NCBI   50S ribosomal protein L19
gi|76798392 Streptococcus agalactiae 18RS21 NCBI   ribosomal protein L19
gi|77159607 Streptococcus agalactiae 515 NCBI   ribosomal protein L19
gi|77162851 Streptococcus agalactiae CJB111 NCBI   ribosomal protein L19
gi|77172878 Streptococcus agalactiae COH1 NCBI   ribosomal protein L19
gi|77174629 Streptococcus agalactiae H36B NCBI   ribosomal protein L19
gi|77406752 Streptococcus agalactiae H36B NCBI   ribosomal protein L19
gi|77408521 Streptococcus agalactiae COH1 NCBI   ribosomal protein L19
gi|77411128 Streptococcus agalactiae CJB111 NCBI   ribosomal protein L19
gi|77414315 Streptococcus agalactiae 515 NCBI   ribosomal protein L19
gi|92090572 organism not parsed/found in ncbi nr NCBI   RecName: Full=50S ribosomal protein L19
img|637315745 Streptococcus agalactiae 2603V/R IMG   50S ribosomal protein L19
img|637349321 Streptococcus agalactiae NEM316 IMG   50S ribosomal protein L19
img|637725045 Streptococcus agalactiae A909 IMG   50S ribosomal protein L19
img|638643780 Streptococcus agalactiae 18RS21 IMG   ribosomal protein L19
img|638646921 Streptococcus agalactiae 515 IMG   ribosomal protein L19
img|638648369 Streptococcus agalactiae CJB111 IMG   ribosomal protein L19
img|638650751 Streptococcus agalactiae COH1 IMG   ribosomal protein L19
img|638654040 Streptococcus agalactiae H36B IMG   ribosomal protein L19
kegg|sag:SAG0544 Streptococcus agalactiae 2603 (serotype V) KEGG   50S ribosomal protein L19
kegg|sak:SAK_0692 Streptococcus agalactiae A909 (serotype Ia) KEGG   50S ribosomal protein L19
kegg|san:gbs0587 Streptococcus agalactiae NEM316 (serotype III) KEGG   50S ribosomal protein L19
kegg|sub:SUB0644 Streptococcus uberis 0140J KEGG   50S ribosomal protein L19
ref|NP_687573.1 Streptococcus agalactiae 2603V/R RefSeq   50S ribosomal protein L19
ref|NP_735051.1 Streptococcus agalactiae NEM316 RefSeq   50S ribosomal protein L19
ref|YP_002561985.1 Streptococcus uberis 0140J RefSeq   50S ribosomal protein L19
ref|YP_329323.1 Streptococcus agalactiae A909 RefSeq   50S ribosomal protein L19
ref|ZP_00780634.1 Streptococcus agalactiae 18RS21 RefSeq   ribosomal protein L19
ref|ZP_00783788.1 Streptococcus agalactiae H36B RefSeq   ribosomal protein L19
ref|ZP_00785258.1 Streptococcus agalactiae COH1 RefSeq   ribosomal protein L19
ref|ZP_00787481.1 Streptococcus agalactiae CJB111 RefSeq   ribosomal protein L19
ref|ZP_00790472.1 Streptococcus agalactiae 515 RefSeq   ribosomal protein L19
sp|B9DRQ9 Streptococcus uberis (strain ATCC BAA-854 / 0140J) SwissProt   50S ribosomal protein L19
sp|Q3K2D0 Streptococcus agalactiae serotype Ia SwissProt   50S ribosomal protein L19
sp|Q8E121 Streptococcus agalactiae serotype V SwissProt   50S ribosomal protein L19
sp|Q8E6H6 Streptococcus agalactiae serotype III SwissProt   50S ribosomal protein L19
sp|RL19_STRA1 organism not parsed/found in ncbi nr SwissProt   RecName: Full=50S ribosomal protein L19
sp|RL19_STRA3 organism not parsed/found in ncbi nr SwissProt   RecName: Full=50S ribosomal protein L19
sp|RL19_STRA5 organism not parsed/found in ncbi nr SwissProt   RecName: Full=50S ribosomal protein L19
sp|RL19_STRU0 organism not parsed/found in ncbi nr SwissProt   RecName: Full=50S ribosomal protein L19
tr|Q3CZQ4 Streptococcus agalactiae H36B TrEMBL   50S ribosomal protein L19
tr|Q3D943 Streptococcus agalactiae COH1 TrEMBL   50S ribosomal protein L19
tr|Q3DFX5 Streptococcus agalactiae CJB111 TrEMBL   50S ribosomal protein L19
tr|Q3DK23 Streptococcus agalactiae 515 TrEMBL   50S ribosomal protein L19
tr|Q3DTA8 Streptococcus agalactiae 18RS21 TrEMBL   50S ribosomal protein L19


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search