The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|208435.3.peg.539: Streptococcus agalactiae 2603V/R

This feature in The SEED Viewer

NCBI Taxonomy Id: 208435

Current Assignment: Mobile element protein
Translate Function Assignments



Context on contig NC_004116 from base 552547 to 563639 (11093 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
533 553482 552547 936 -       2: 4 2   3'-to-5' oligoribonuclease A, Bacillus type locus|SAG0537, protein_id|NP_687566.1, gi|22536715, geneID|1013340
534 553748 554770 1023 + 265     3: 7 5 6   Adenosine deaminase (EC 3.5.4.4) locus|SAG0538, protein_id|NP_687567.1, gi|22536716, geneID|1013341
535 554829 555272 444 + 58     1: 14   Flavodoxin locus|SAG0539, protein_id|NP_687568.1, gi|22536717, geneID|1013342
536 555349 555624 276 + 76     5: 12 13 16 1 11   Chorismate mutase I (EC 5.4.99.5) locus|SAG0540, protein_id|NP_687569.1, gi|22536718, geneID|1013343
537 555617 556813 1197 + -8     1: 3   EriC-type fluoride/proton exchange protein locus|SAG0541, protein_id|NP_687570.1, gi|22536719, geneID|1013344
538 557266 557649 384 + 452         IS1381, transposase OrfA locus|SAG0542, protein_id|NP_687571.1, gi|22536720, geneID|1013345
539 557682 558071 390 + 32         Mobile element protein locus|SAG0543, protein_id|NP_687572.1, gi|22536721, geneID|1013346
540 558254 558601 348 + 182     4: 15 10 8 9   LSU ribosomal protein L19p gene_name|rplS, locus|SAG0544, protein_id|NP_687573.1, gi|22536722, geneID|1013347
rna.91 558712 558783 72 + 110         tRNA-Arg-CCT  
541 559905 558826 1080 - 42         Integrase locus|SAG0545, protein_id|NP_687574.1, gi|22536723, geneID|1013349
542 560092 559910 183 - 4         hypothetical protein  
543 560891 560334 558 - 241         hypothetical protein locus|SAG0547, protein_id|NP_687576.1, gi|22536725, geneID|1013351
544 561690 560893 798 - 1         Phage CI-like repressor locus|SAG0548, protein_id|NP_687577.1, gi|22536726, geneID|1013352
545 562051 562194 144 + 360         hypothetical protein locus|SAG0549, protein_id|NP_687578.1, gi|22536727, geneID|1013353
546 562415 562191 225 - -4         hypothetical protein locus|SAG0550, protein_id|NP_687579.1, gi|22536728, geneID|1013354
547 562474 562632 159 + 58         FIG01115240: hypothetical protein locus|SAG0551, protein_id|NP_687580.1, gi|22536729, geneID|1013355
548 562662 562850 189 + 29         hypothetical protein locus|SAG0552, protein_id|NP_687581.1, gi|22536730, geneID|1013356
549 563639 562833 807 - -18         hypothetical protein locus|SAG0553, protein_id|NP_687582.1, gi|22536731, geneID|1013357

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|208435.3.peg.539 Mobile element protein
MKAQAIVTSQGRIVSLDIAVNYCHDMKLFKMSRRNIGQAAKILADSGYQGIMKMYSQAQT
PRKSSKLKPLTLEDKTYNHTLSKERIKVENIFAKVKTFKIFSTTYRNRRKRFGLRMNLIA
GMINRELGF

MD5 = 8fcb2ea4721245037ccdaee8ea401fa4


  DNA Sequence

>fig|208435.3.peg.539 Mobile element protein
atgaaggctcaggcgattgtcacaagccaagggagaattgtttctttggatattgcagtg
aactattgccacgatatgaagttgttcaaaatgagtcgcagaaacatcggacaagctgct
aaaatcttggcagacagtggttatcaagggatcatgaagatgtattcacaagcgcaaact
ccgaggaaatcaagcaaacttaagccactaactcttgaagataaaacctataaccatacg
ctatccaaagagagaatcaaggttgagaatatttttgccaaagtaaaaacgtttaaaata
ttttcaacaacctatcgaaatcgacgcaaacggtttggattacgaatgaatttgattgct
ggaatgatcaaccgtgaactaggattttag


  DNA with Flanking Sequence

>fig|208435.3.peg.539 Mobile element protein
aatcagaaaaaagctaacctagaaacagtaaatcaaatttaaataatagacttcctgcga
aacaaaatatggtacaatagttctatgaattatgaagcaagcaaacaattaactgatgta
cgatttaagcgccttgttggtgttcagcgcactacttttgaagagatgttagctgtgtta
aaaacagcttatcaacgtaaacacgcaaaaggtggccgaacccctaagttaagcttagaa
gatctcctcatggctactcttcaatacatgcgagaataccgcacttatgaacaaattgcg
gctgattttggcattcacgaaagcaacttaatccgtcgaagtcaatgggttgaatcaact
cttattcaaagtggttttacgatttcaaaaactcatcttagtgctgaggatacggtgatt
gtggatgcaacagaggtaaaaatcaatcgtcctaaaaaaatcaactagcgaattattctg
gtaaaaagaaatgtcatgctatgaaggctcaggcgattgtcacaagccaagggagaattg
tttctttggatattgcagtgaactattgccacgatatgaagttgttcaaaatgagtcgca
gaaacatcggacaagctgctaaaatcttggcagacagtggttatcaagggatcatgaaga
tgtattcacaagcgcaaactccgaggaaatcaagcaaacttaagccactaactcttgaag
ataaaacctataaccatacgctatccaaagagagaatcaaggttgagaatatttttgcca
aagtaaaaacgtttaaaatattttcaacaacctatcgaaatcgacgcaaacggtttggat
tacgaatgaatttgattgctggaatgatcaaccgtgaactaggattttagtttcgcagga
agtctaatatacaaataactattctaaaggatgacaccttgttcttctagataaaatagc
tttacaagtaggttaaaatttggtagaattgtgagagtgtgtgatggacgcacaaaaaac
ggctaatccgctgagacaagtacttaagattagtaagagaaggagaataaaaatgaatcc
attaattcaaagtttgacagaaggtcaacttcgttctgatatccctgagttccgtgctgg
tgatactgtacgtgttcacgctaaagttgtcgaaggtactcgcgaacgtattcagatctt
tgaaggtgttgttatctcacgtaaaggtcaaggaatctcagaaatgtacacagtacgtaa
aatttctggtggtatcggtgtagagcgtacattcccaattcacactcctcgtgttgataa
aatcgaagttgttcgttatggtaaagtacgtcgtgctaaactttactacttacgcgcatt
gcaaggtaaa


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0003677       F:DNA binding
GO:0004803       F:transposase activity
GO:0006313       P:transposition, DNA-mediated
cmr|SAG_0261 Streptococcus agalactiae 2603V/R     IS1381, transposase OrfB
cmr|SAG_0543 Streptococcus agalactiae 2603V/R     IS1381, transposase OrfB
cmr|SAG_0966 Streptococcus agalactiae 2603V/R     IS1381, transposase OrfB
cmr|SAG_1457 Streptococcus agalactiae 2603V/R     IS1381, transposase OrfB
cmr|SAG_1550 Streptococcus agalactiae 2603V/R     IS1381, transposase OrfB
cmr|SAG_2002 Streptococcus agalactiae 2603V/R     IS1381, transposase OrfB
cmr|SAI_1029 Streptococcus agalactiae H36B     Transposase (IS4 family)
cmr|SAI_1041 Streptococcus agalactiae H36B     Transposase (IS4 family)
cmr|SAI_1200 Streptococcus agalactiae H36B     Transposase (IS4 family)
cmr|SAI_1476 Streptococcus agalactiae H36B     Transposase (IS4 family)
cmr|SAI_2139 Streptococcus agalactiae H36B     Transposase (IS4 family)
cmr|SAI_2166 Streptococcus agalactiae H36B     Transposase (IS4 family)
cmr|SAI_2267 Streptococcus agalactiae H36B     Transposase (IS4 family)
cmr|SAJ_0539 Streptococcus agalactiae 18RS21     Transposase (IS4 family)
cmr|SAJ_0540 Streptococcus agalactiae 18RS21     Transposase (IS4 family)
cmr|SAJ_0911 Streptococcus agalactiae 18RS21     Transposase (IS4 family)
cmr|SAJ_1005 Streptococcus agalactiae 18RS21     Transposase (IS4 family)
cmr|SAJ_1267 Streptococcus agalactiae 18RS21     Transposase (IS4 family)
cmr|SAK_0190 Streptococcus agalactiae A909     IS1381, transposase orfB
cmr|SAK_0541 Streptococcus agalactiae A909     IS1381, transposase orfB
cmr|SAK_1061 Streptococcus agalactiae A909     IS1381, transposase orfB
cmr|SAK_1208 Streptococcus agalactiae A909     IS1381, transposase orfB
cmr|SAK_1969 Streptococcus agalactiae A909     IS1381, transposase orfB
cmr|SAK_2001 Streptococcus agalactiae A909     IS1381, transposase orfB
cmr|SAL_1230 Streptococcus agalactiae 515     Transposase (IS4 family)
cmr|SAL_1413 Streptococcus agalactiae 515     Transposase (IS4 family)
cmr|SAM_1808 Streptococcus agalactiae CJB111     Transposase (IS4 family)
cmr|SAM_1936 Streptococcus agalactiae CJB111     Transposase (IS4 family)
cmr|SAM_2035 Streptococcus agalactiae CJB111     Transposase (IS4 family)
dbj|BAE45250.1 Streptococcus agalactiae     putative transposase
fig|205921.3.peg.1083 Streptococcus agalactiae A909 FIG   Mobile element protein
fig|205921.3.peg.1133 Streptococcus agalactiae A909 FIG   Mobile element protein
fig|205921.3.peg.136 Streptococcus agalactiae A909 FIG   Mobile element protein
fig|205921.3.peg.1498 Streptococcus agalactiae A909 FIG   Mobile element protein
fig|205921.3.peg.533 Streptococcus agalactiae A909 FIG   Mobile element protein
fig|205921.3.peg.956 Streptococcus agalactiae A909 FIG   Mobile element protein
fig|205921.4.peg.1003 Streptococcus agalactiae A909 FIG   Mobile element protein
fig|205921.4.peg.1151 Streptococcus agalactiae A909 FIG   Mobile element protein
fig|205921.4.peg.138 Streptococcus agalactiae A909 FIG   Mobile element protein
fig|205921.4.peg.1946 Streptococcus agalactiae A909 FIG   Mobile element protein
fig|205921.4.peg.1979 Streptococcus agalactiae A909 FIG   Mobile element protein
fig|205921.4.peg.464 Streptococcus agalactiae A909 FIG   Mobile element protein
fig|208435.1.peg.1416 Streptococcus agalactiae 2603V/R FIG   Mobile element protein
fig|208435.1.peg.1507 Streptococcus agalactiae 2603V/R FIG   Mobile element protein
fig|208435.1.peg.1953 Streptococcus agalactiae 2603V/R FIG   Mobile element protein
fig|208435.1.peg.260 Streptococcus agalactiae 2603V/R FIG   Mobile element protein
fig|208435.1.peg.536 Streptococcus agalactiae 2603V/R FIG   Mobile element protein
fig|208435.1.peg.942 Streptococcus agalactiae 2603V/R FIG   Mobile element protein
fig|208435.3.peg.1465 Streptococcus agalactiae 2603V/R FIG   Mobile element protein
fig|208435.3.peg.1559 Streptococcus agalactiae 2603V/R FIG   Mobile element protein
fig|208435.3.peg.2007 Streptococcus agalactiae 2603V/R FIG   Mobile element protein
fig|208435.3.peg.259 Streptococcus agalactiae 2603V/R FIG   Mobile element protein
fig|208435.3.peg.972 Streptococcus agalactiae 2603V/R FIG   Mobile element protein
fig|342613.5.peg.168 Streptococcus agalactiae 18RS21 FIG   Mobile element protein
fig|342613.5.peg.1884 Streptococcus agalactiae 18RS21 FIG   Mobile element protein
fig|342613.5.peg.364 Streptococcus agalactiae 18RS21 FIG   Mobile element protein
fig|342613.5.peg.531 Streptococcus agalactiae 18RS21 FIG   Mobile element protein
fig|342613.5.peg.993 Streptococcus agalactiae 18RS21 FIG   Mobile element protein
fig|342614.4.peg.2042 Streptococcus agalactiae 515 FIG   Mobile element protein
fig|342614.4.peg.233 Streptococcus agalactiae 515 FIG   Mobile element protein
fig|342615.4.peg.1407 Streptococcus agalactiae H36B FIG   Mobile element protein
fig|342615.4.peg.157 Streptococcus agalactiae H36B FIG   Mobile element protein
fig|342615.4.peg.1884 Streptococcus agalactiae H36B FIG   Mobile element protein
fig|342615.4.peg.665 Streptococcus agalactiae H36B FIG   Mobile element protein
fig|342615.4.peg.747 Streptococcus agalactiae H36B FIG   Mobile element protein
fig|342615.4.peg.760 Streptococcus agalactiae H36B FIG   Mobile element protein
fig|342615.4.peg.884 Streptococcus agalactiae H36B FIG   Mobile element protein
fig|342617.4.peg.1063 Streptococcus agalactiae CJB111 FIG   Mobile element protein
fig|342617.4.peg.1489 Streptococcus agalactiae CJB111 FIG   Mobile element protein
fig|342617.4.peg.427 Streptococcus agalactiae CJB111 FIG   Mobile element protein
gb|AAM99168.1 Streptococcus agalactiae 2603V/R     IS1381, transposase OrfB
gb|AAM99444.1 Streptococcus agalactiae 2603V/R     IS1381, transposase OrfB
gb|AAM99850.1 Streptococcus agalactiae 2603V/R     IS1381, transposase OrfB
gb|AAN00325.1 Streptococcus agalactiae 2603V/R     IS1381, transposase OrfB
gb|AAN00416.1 Streptococcus agalactiae 2603V/R     IS1381, transposase OrfB
gb|AAN00862.1 Streptococcus agalactiae 2603V/R     IS1381, transposase OrfB
gb|AAT10381.1 Streptococcus agalactiae     putative transposase
gb|ABA44898.1 Streptococcus agalactiae A909     IS1381, transposase orfB
gb|ABA45183.1 Streptococcus agalactiae A909     IS1381, transposase orfB
gb|ABA45309.1 Streptococcus agalactiae A909     IS1381, transposase orfB
gb|ABA45889.1 Streptococcus agalactiae A909     IS1381, transposase orfB
gb|ABA46272.1 Streptococcus agalactiae A909     IS1381, transposase orfB
gb|ABA46298.1 Streptococcus agalactiae A909     IS1381, transposase orfB
gb|ABD95567.1 Streptococcus agalactiae     transposase OrfB
gb|AE014203_15 Streptococcus agalactiae 2603V/R     IS1381, transposase OrfB
gb|AE014216_20 Streptococcus agalactiae 2603V/R     IS1381, transposase OrfB
gb|AE014236_4 Streptococcus agalactiae 2603V/R     IS1381, transposase OrfB
gb|AE014258_12 Streptococcus agalactiae 2603V/R     IS1381, transposase OrfB
gb|AE014262_21 Streptococcus agalactiae 2603V/R     IS1381, transposase OrfB
gb|AE014282_4 Streptococcus agalactiae 2603V/R     IS1381, transposase OrfB
gb|EAO61632.1 Streptococcus agalactiae 18RS21     Transposase (IS4 family)
gb|EAO62531.1 Streptococcus agalactiae 18RS21     Transposase (IS4 family)
gb|EAO62977.1 Streptococcus agalactiae 18RS21     Transposase (IS4 family)
gb|EAO63123.1 Streptococcus agalactiae 18RS21     Transposase (IS4 family)
gb|EAO63347.1 Streptococcus agalactiae 18RS21     Transposase (IS4 family)
gb|EAO70173.1 Streptococcus agalactiae 515     Transposase (IS4 family)
gb|EAO72056.1 Streptococcus agalactiae 515     Transposase (IS4 family)
gb|EAO72963.1 Streptococcus agalactiae CJB111     Transposase (IS4 family)
gb|EAO73379.1 Streptococcus agalactiae CJB111     Transposase (IS4 family)
gb|EAO74059.1 Streptococcus agalactiae CJB111     Transposase (IS4 family)
gb|EAO77329.1 Streptococcus agalactiae H36B     Transposase (IS4 family)
gb|EAO77810.1 Streptococcus agalactiae H36B     Transposase (IS4 family)
gb|EAO78356.1 Streptococcus agalactiae H36B     Transposase (IS4 family)
gb|EAO78460.1 Streptococcus agalactiae H36B     Transposase (IS4 family)
gb|EAO78491.1 Streptococcus agalactiae H36B     Transposase (IS4 family)
gb|EAO78535.1 Streptococcus agalactiae H36B     Transposase (IS4 family)
gb|EAO79049.1 Streptococcus agalactiae H36B     Transposase (IS4 family)
gi|22533274 Streptococcus agalactiae 2603V/R NCBI   IS1381, transposase OrfB
gi|22533563 Streptococcus agalactiae 2603V/R NCBI   IS1381, transposase OrfB
gi|22533989 Streptococcus agalactiae 2603V/R NCBI   IS1381, transposase OrfB
gi|22534485 Streptococcus agalactiae 2603V/R NCBI   IS1381, transposase OrfB
gi|22534580 Streptococcus agalactiae 2603V/R NCBI   IS1381, transposase OrfB
gi|22535046 Streptococcus agalactiae 2603V/R NCBI   IS1381, transposase OrfB
gi|22536445 Streptococcus agalactiae 2603V/R NCBI   IS1381 transposase protein B
gi|22536721 Streptococcus agalactiae 2603V/R NCBI   IS1381 transposase protein B
gi|22537127 Streptococcus agalactiae 2603V/R NCBI   IS1381 transposase protein B
gi|22537601 Streptococcus agalactiae 2603V/R NCBI   IS1381 transposase protein B
gi|22537692 Streptococcus agalactiae 2603V/R NCBI   IS1381 transposase protein B
gi|22538138 Streptococcus agalactiae 2603V/R NCBI   IS1381 transposase protein B
gi|47087865 Streptococcus agalactiae NCBI   putative transposase
gi|76150607 Streptococcus agalactiae NCBI   putative transposase
gi|76562314 Streptococcus agalactiae A909 NCBI   IS1381, transposase orfB
gi|76562599 Streptococcus agalactiae A909 NCBI   IS1381, transposase orfB
gi|76562725 Streptococcus agalactiae A909 NCBI   IS1381, transposase orfB
gi|76563305 Streptococcus agalactiae A909 NCBI   IS1381, transposase orfB
gi|76563688 Streptococcus agalactiae A909 NCBI   IS1381, transposase orfB
gi|76563714 Streptococcus agalactiae A909 NCBI   IS1381, transposase orfB
gi|76584982 Streptococcus agalactiae 18RS21 NCBI   Transposase (IS4 family)
gi|76585999 Streptococcus agalactiae 18RS21 NCBI   Transposase (IS4 family)
gi|76586471 Streptococcus agalactiae 18RS21 NCBI   Transposase (IS4 family)
gi|76586623 Streptococcus agalactiae 18RS21 NCBI   Transposase (IS4 family)
gi|76586855 Streptococcus agalactiae 18RS21 NCBI   Transposase (IS4 family)
gi|76787257 Streptococcus agalactiae A909 NCBI   IS1381 transposase protein B
gi|76787542 Streptococcus agalactiae A909 NCBI   IS1381 transposase protein B
gi|76787668 Streptococcus agalactiae A909 NCBI   IS1381 transposase protein B
gi|76788248 Streptococcus agalactiae A909 NCBI   IS1381 transposase protein B
gi|76788631 Streptococcus agalactiae A909 NCBI   IS1381 transposase protein B
gi|76788657 Streptococcus agalactiae A909 NCBI   IS1381 transposase protein B
gi|76797779 Streptococcus agalactiae 18RS21 NCBI   Transposase (IS4 family)
gi|76798000 Streptococcus agalactiae 18RS21 NCBI   Transposase (IS4 family)
gi|76798163 Streptococcus agalactiae 18RS21 NCBI   Transposase (IS4 family)
gi|76798634 Streptococcus agalactiae 18RS21 NCBI   Transposase (IS4 family)
gi|76799663 Streptococcus agalactiae 18RS21 NCBI   Transposase (IS4 family)
gi|77158942 Streptococcus agalactiae 515 NCBI   Transposase (IS4 family)
gi|77160947 Streptococcus agalactiae 515 NCBI   Transposase (IS4 family)
gi|77161982 Streptococcus agalactiae CJB111 NCBI   Transposase (IS4 family)
gi|77162411 Streptococcus agalactiae CJB111 NCBI   Transposase (IS4 family)
gi|77163105 Streptococcus agalactiae CJB111 NCBI   Transposase (IS4 family)
gi|77174484 Streptococcus agalactiae H36B NCBI   Transposase (IS4 family)
gi|77175002 Streptococcus agalactiae H36B NCBI   Transposase (IS4 family)
gi|77175570 Streptococcus agalactiae H36B NCBI   Transposase (IS4 family)
gi|77175678 Streptococcus agalactiae H36B NCBI   Transposase (IS4 family)
gi|77175709 Streptococcus agalactiae H36B NCBI   Transposase (IS4 family)
gi|77175755 Streptococcus agalactiae H36B NCBI   Transposase (IS4 family)
gi|77176279 Streptococcus agalactiae H36B NCBI   Transposase (IS4 family)
gi|77405136 Streptococcus agalactiae H36B NCBI   Transposase (IS4 family)
gi|77405611 Streptococcus agalactiae H36B NCBI   Transposase (IS4 family)
gi|77405682 Streptococcus agalactiae H36B NCBI   Transposase (IS4 family)
gi|77405713 Streptococcus agalactiae H36B NCBI   Transposase (IS4 family)
gi|77405860 Streptococcus agalactiae H36B NCBI   Transposase (IS4 family)
gi|77406378 Streptococcus agalactiae H36B NCBI   Transposase (IS4 family)
gi|77406898 Streptococcus agalactiae H36B NCBI   Transposase (IS4 family)
gi|77410887 Streptococcus agalactiae CJB111 NCBI   Transposase (IS4 family)
gi|77411557 Streptococcus agalactiae CJB111 NCBI   Transposase (IS4 family)
gi|77411956 Streptococcus agalactiae CJB111 NCBI   Transposase (IS4 family)
gi|77413049 Streptococcus agalactiae 515 NCBI   Transposase (IS4 family)
gi|77415008 Streptococcus agalactiae 515 NCBI   Transposase (IS4 family)
gi|90576977 Streptococcus agalactiae NCBI   transposase OrfB
img|637315454 Streptococcus agalactiae 2603V/R IMG   IS1381 transposase protein B
img|637315744 Streptococcus agalactiae 2603V/R IMG   IS1381 transposase protein B
img|637316151 Streptococcus agalactiae 2603V/R IMG   IS1381 transposase protein B
img|637316630 Streptococcus agalactiae 2603V/R IMG   IS1381 transposase protein B
img|637316721 Streptococcus agalactiae 2603V/R IMG   IS1381 transposase protein B
img|637317169 Streptococcus agalactiae 2603V/R IMG   IS1381 transposase protein B
img|637724549 Streptococcus agalactiae A909 IMG   IS1381 transposase protein B
img|637724895 Streptococcus agalactiae A909 IMG   IS1381 transposase protein B
img|637725405 Streptococcus agalactiae A909 IMG   IS1381 transposase protein B
img|637725552 Streptococcus agalactiae A909 IMG   IS1381 transposase protein B
img|637726291 Streptococcus agalactiae A909 IMG   IS1381 transposase protein B
img|637726322 Streptococcus agalactiae A909 IMG   IS1381 transposase protein B
img|638643200 Streptococcus agalactiae 18RS21 IMG   Transposase (IS4 family)
img|638643400 Streptococcus agalactiae 18RS21 IMG   Transposase (IS4 family)
img|638643563 Streptococcus agalactiae 18RS21 IMG   Transposase (IS4 family)
img|638644034 Streptococcus agalactiae 18RS21 IMG   Transposase (IS4 family)
img|638644968 Streptococcus agalactiae 18RS21 IMG   Transposase (IS4 family)
img|638645684 Streptococcus agalactiae 515 IMG   Transposase (IS4 family)
img|638647542 Streptococcus agalactiae 515 IMG   Transposase (IS4 family)
img|638648155 Streptococcus agalactiae CJB111 IMG   Transposase (IS4 family)
img|638648802 Streptococcus agalactiae CJB111 IMG   Transposase (IS4 family)
img|638649233 Streptococcus agalactiae CJB111 IMG   Transposase (IS4 family)
img|638652455 Streptococcus agalactiae H36B IMG   Transposase (IS4 family)
img|638652957 Streptococcus agalactiae H36B IMG   Transposase (IS4 family)
img|638653043 Streptococcus agalactiae H36B IMG   Transposase (IS4 family)
img|638653055 Streptococcus agalactiae H36B IMG   Transposase (IS4 family)
img|638653177 Streptococcus agalactiae H36B IMG   Transposase (IS4 family)
img|638653701 Streptococcus agalactiae H36B IMG   Transposase (IS4 family)
img|638654177 Streptococcus agalactiae H36B IMG   Transposase (IS4 family)
kegg|sag:SAG0261 Streptococcus agalactiae 2603 (serotype V) KEGG   IS1381 transposase protein B
kegg|sag:SAG0543 Streptococcus agalactiae 2603 (serotype V) KEGG   IS1381 transposase protein B
kegg|sag:SAG0966 Streptococcus agalactiae 2603 (serotype V) KEGG   IS1381 transposase protein B
kegg|sag:SAG1457 Streptococcus agalactiae 2603 (serotype V) KEGG   IS1381 transposase protein B
kegg|sag:SAG1550 Streptococcus agalactiae 2603 (serotype V) KEGG   IS1381 transposase protein B
kegg|sag:SAG2002 Streptococcus agalactiae 2603 (serotype V) KEGG   IS1381 transposase protein B
kegg|sak:SAK_0190 Streptococcus agalactiae A909 (serotype Ia) KEGG   IS1381 transposase protein B
kegg|sak:SAK_0541 Streptococcus agalactiae A909 (serotype Ia) KEGG   IS1381 transposase protein B
kegg|sak:SAK_1061 Streptococcus agalactiae A909 (serotype Ia) KEGG   IS1381 transposase protein B
kegg|sak:SAK_1208 Streptococcus agalactiae A909 (serotype Ia) KEGG   IS1381 transposase protein B
kegg|sak:SAK_1969 Streptococcus agalactiae A909 (serotype Ia) KEGG   IS1381 transposase protein B
kegg|sak:SAK_2001 Streptococcus agalactiae A909 (serotype Ia) KEGG   IS1381 transposase protein B
ref|NP_687296.1 Streptococcus agalactiae 2603V/R RefSeq   IS1381 transposase protein B
ref|NP_687572.1 Streptococcus agalactiae 2603V/R RefSeq   IS1381 transposase protein B
ref|NP_687978.1 Streptococcus agalactiae 2603V/R RefSeq   IS1381 transposase protein B
ref|NP_688452.1 Streptococcus agalactiae 2603V/R RefSeq   IS1381 transposase protein B
ref|NP_688543.1 Streptococcus agalactiae 2603V/R RefSeq   IS1381 transposase protein B
ref|NP_688989.1 Streptococcus agalactiae 2603V/R RefSeq   IS1381 transposase protein B
ref|YP_328863.1 Streptococcus agalactiae A909 RefSeq   IS1381 transposase protein B
ref|YP_329173.1 Streptococcus agalactiae A909 RefSeq   IS1381 transposase protein B
ref|YP_329682.1 Streptococcus agalactiae A909 RefSeq   IS1381 transposase protein B
ref|YP_329829.1 Streptococcus agalactiae A909 RefSeq   IS1381 transposase protein B
ref|YP_330561.1 Streptococcus agalactiae A909 RefSeq   IS1381 transposase protein B
ref|YP_330592.1 Streptococcus agalactiae A909 RefSeq   IS1381 transposase protein B
ref|ZP_00780045.1 Streptococcus agalactiae 18RS21 RefSeq   Transposase (IS4 family)
ref|ZP_00780258.1 Streptococcus agalactiae 18RS21 RefSeq   Transposase (IS4 family)
ref|ZP_00780415.1 Streptococcus agalactiae 18RS21 RefSeq   Transposase (IS4 family)
ref|ZP_00780860.1 Streptococcus agalactiae 18RS21 RefSeq   Transposase (IS4 family)
ref|ZP_00781771.1 Streptococcus agalactiae 18RS21 RefSeq   Transposase (IS4 family)
ref|ZP_00782235.1 Streptococcus agalactiae H36B RefSeq   Transposase (IS4 family)
ref|ZP_00782700.1 Streptococcus agalactiae H36B RefSeq   Transposase (IS4 family)
ref|ZP_00782769.1 Streptococcus agalactiae H36B RefSeq   Transposase (IS4 family)
ref|ZP_00782800.1 Streptococcus agalactiae H36B RefSeq   Transposase (IS4 family)
ref|ZP_00782943.1 Streptococcus agalactiae H36B RefSeq   Transposase (IS4 family)
ref|ZP_00783439.1 Streptococcus agalactiae H36B RefSeq   Transposase (IS4 family)
ref|ZP_00783922.1 Streptococcus agalactiae H36B RefSeq   Transposase (IS4 family)
ref|ZP_00787244.1 Streptococcus agalactiae CJB111 RefSeq   Transposase (IS4 family)
ref|ZP_00787900.1 Streptococcus agalactiae CJB111 RefSeq   Transposase (IS4 family)
ref|ZP_00788286.1 Streptococcus agalactiae CJB111 RefSeq   Transposase (IS4 family)
ref|ZP_00789251.1 Streptococcus agalactiae 515 RefSeq   Transposase (IS4 family)
ref|ZP_00791088.1 Streptococcus agalactiae 515 RefSeq   Transposase (IS4 family)
tr|Q3D489 Streptococcus agalactiae H36B TrEMBL   Transposase (IS4 family)
tr|Q3DGI9 Streptococcus agalactiae CJB111 TrEMBL   Transposase (IS4 family)
tr|Q3DNL0 Streptococcus agalactiae 515 TrEMBL   Transposase (IS4 family)
tr|Q3DUX6 Streptococcus agalactiae 18RS21 TrEMBL   Transposase (IS4 family)
tr|Q3K2T0 Streptococcus agalactiae serotype Ia TrEMBL   IS1381, transposase orfB
tr|Q6J5M0 Streptococcus agalactiae TrEMBL   Putative transposase
tr|Q8CMF6 Streptococcus agalactiae serotype V TrEMBL   IS1381, transposase OrfB


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search