The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|208435.3.peg.538: Streptococcus agalactiae 2603V/R

This feature in The SEED Viewer

NCBI Taxonomy Id: 208435

Current Assignment: IS1381, transposase OrfA
Translate Function Assignments



Context on contig NC_004116 from base 552178 to 562632 (10455 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
532 552438 552178 261 -       3: 2 1 3   LSU ribosomal protein L31p @ LSU ribosomal protein L31p, zinc-independent gene_name|rpmE2, locus|SAG0536, protein_id|NP_687565.1, gi|22536714, geneID|1013339
533 553482 552547 936 - 108     2: 7 5   3'-to-5' oligoribonuclease A, Bacillus type locus|SAG0537, protein_id|NP_687566.1, gi|22536715, geneID|1013340
534 553748 554770 1023 + 265     3: 10 8 9   Adenosine deaminase (EC 3.5.4.4) locus|SAG0538, protein_id|NP_687567.1, gi|22536716, geneID|1013341
535 554829 555272 444 + 58     1: 16   Flavodoxin locus|SAG0539, protein_id|NP_687568.1, gi|22536717, geneID|1013342
536 555349 555624 276 + 76     5: 13 14 17 4 12   Chorismate mutase I (EC 5.4.99.5) locus|SAG0540, protein_id|NP_687569.1, gi|22536718, geneID|1013343
537 555617 556813 1197 + -8     1: 6   EriC-type fluoride/proton exchange protein locus|SAG0541, protein_id|NP_687570.1, gi|22536719, geneID|1013344
538 557266 557649 384 + 452         IS1381, transposase OrfA locus|SAG0542, protein_id|NP_687571.1, gi|22536720, geneID|1013345
539 557682 558071 390 + 32         Mobile element protein locus|SAG0543, protein_id|NP_687572.1, gi|22536721, geneID|1013346
540 558254 558601 348 + 182     4: 15 2 1 11   LSU ribosomal protein L19p gene_name|rplS, locus|SAG0544, protein_id|NP_687573.1, gi|22536722, geneID|1013347
rna.91 558712 558783 72 + 110         tRNA-Arg-CCT  
541 559905 558826 1080 - 42         Integrase locus|SAG0545, protein_id|NP_687574.1, gi|22536723, geneID|1013349
542 560092 559910 183 - 4         hypothetical protein  
543 560891 560334 558 - 241         hypothetical protein locus|SAG0547, protein_id|NP_687576.1, gi|22536725, geneID|1013351
544 561690 560893 798 - 1         Phage CI-like repressor locus|SAG0548, protein_id|NP_687577.1, gi|22536726, geneID|1013352
545 562051 562194 144 + 360         hypothetical protein locus|SAG0549, protein_id|NP_687578.1, gi|22536727, geneID|1013353
546 562415 562191 225 - -4         hypothetical protein locus|SAG0550, protein_id|NP_687579.1, gi|22536728, geneID|1013354
547 562474 562632 159 + 58         FIG01115240: hypothetical protein locus|SAG0551, protein_id|NP_687580.1, gi|22536729, geneID|1013355

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|208435.3.peg.538 IS1381, transposase OrfA
MNYEASKQLTDVRFKRLVGVQRTTFEEMLAVLKTAYQRKHAKGGRTPKLSLEDLLMATLQ
YMREYRTYEQIAADFGIHESNLIRRSQWVESTLIQSGFTISKTHLSAEDTVIVDATEVKI
NRPKKIN

MD5 = 3e7fc5fd678730e3187546a9ee40ed24


  DNA Sequence

>fig|208435.3.peg.538 IS1381, transposase OrfA
atgaattatgaagcaagcaaacaattaactgatgtacgatttaagcgccttgttggtgtt
cagcgcactacttttgaagagatgttagctgtgttaaaaacagcttatcaacgtaaacac
gcaaaaggtggccgaacccctaagttaagcttagaagatctcctcatggctactcttcaa
tacatgcgagaataccgcacttatgaacaaattgcggctgattttggcattcacgaaagc
aacttaatccgtcgaagtcaatgggttgaatcaactcttattcaaagtggttttacgatt
tcaaaaactcatcttagtgctgaggatacggtgattgtggatgcaacagaggtaaaaatc
aatcgtcctaaaaaaatcaactag


  DNA with Flanking Sequence

>fig|208435.3.peg.538 IS1381, transposase OrfA
tactccatatcacatgctcatacgatttatggtgctcaatctagatagttagtgatgagt
tttaaaagagtttatcagtttgtagaacggaatattccgttctcttttttattctcttaa
agtttataaaaatggagtttgtcaattttatgaatgcaaaaattatgtggctaatataat
ttcttcaaagaaattgattttatgattgtcattaaaatactgtaaaatccaattgaatgt
gtaggaacttaggttaggataatgtctacaagcatttaagtcgcgatggtgaaatgcatt
ataagataaaaagttgatgtggatttcaactttatgggaaagagttaagtgacacgaaag
ctaatatagaaaacgtagcttaaaaaatcaaatattaaatgaattaaactctcaaaaatc
agaaaaaagctaacctagaaacagtaaatcaaatttaaataatagacttcctgcgaaaca
aaatatggtacaatagttctatgaattatgaagcaagcaaacaattaactgatgtacgat
ttaagcgccttgttggtgttcagcgcactacttttgaagagatgttagctgtgttaaaaa
cagcttatcaacgtaaacacgcaaaaggtggccgaacccctaagttaagcttagaagatc
tcctcatggctactcttcaatacatgcgagaataccgcacttatgaacaaattgcggctg
attttggcattcacgaaagcaacttaatccgtcgaagtcaatgggttgaatcaactctta
ttcaaagtggttttacgatttcaaaaactcatcttagtgctgaggatacggtgattgtgg
atgcaacagaggtaaaaatcaatcgtcctaaaaaaatcaactagcgaattattctggtaa
aaagaaatgtcatgctatgaaggctcaggcgattgtcacaagccaagggagaattgtttc
tttggatattgcagtgaactattgccacgatatgaagttgttcaaaatgagtcgcagaaa
catcggacaagctgctaaaatcttggcagacagtggttatcaagggatcatgaagatgta
ttcacaagcgcaaactccgaggaaatcaagcaaacttaagccactaactcttgaagataa
aacctataaccatacgctatccaaagagagaatcaaggttgagaatatttttgccaaagt
aaaaacgtttaaaatattttcaacaacctatcgaaatcgacgcaaacggtttggattacg
aatgaatttgattgctggaatgatcaaccgtgaactaggattttagtttcgcaggaagtc
taatatacaaataactattctaaaggatgacaccttgttcttctagataaaatagcttta
caag


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
cmr|SAG_0262 Streptococcus agalactiae 2603V/R     IS1381, transposase OrfA
cmr|SAG_0542 Streptococcus agalactiae 2603V/R     IS1381, transposase OrfA
cmr|SAG_0965 Streptococcus agalactiae 2603V/R     IS1381, transposase OrfA
cmr|SAG_1458 Streptococcus agalactiae 2603V/R     IS1381, transposase OrfA
cmr|SAG_1549 Streptococcus agalactiae 2603V/R     IS1381, transposase OrfA
cmr|SAG_2003 Streptococcus agalactiae 2603V/R     IS1381, transposase OrfA
cmr|SAI_1028 Streptococcus agalactiae H36B     degenerate transposase (orf1)
cmr|SAI_1201 Streptococcus agalactiae H36B     degenerate transposase (orf1)
cmr|SAI_1477 Streptococcus agalactiae H36B     degenerate transposase (orf1)
cmr|SAI_2061 Streptococcus agalactiae H36B     degenerate transposase (orf1)
cmr|SAI_2138 Streptococcus agalactiae H36B     degenerate transposase (orf1)
cmr|SAI_2165 Streptococcus agalactiae H36B     degenerate transposase (orf1)
cmr|SAI_2268 Streptococcus agalactiae H36B     degenerate transposase (orf1)
cmr|SAJ_0538 Streptococcus agalactiae 18RS21     degenerate transposase
cmr|SAJ_0912 Streptococcus agalactiae 18RS21     degenerate transposase
cmr|SAJ_1004 Streptococcus agalactiae 18RS21     degenerate transposase
cmr|SAJ_1266 Streptococcus agalactiae 18RS21     degenerate transposase
cmr|SAK_0191 Streptococcus agalactiae A909     IS1381, transposase orfA
cmr|SAK_0540 Streptococcus agalactiae A909     IS1381, transposase orfA
cmr|SAK_1060 Streptococcus agalactiae A909     IS1381, transposase orfA
cmr|SAK_1970 Streptococcus agalactiae A909     IS1381, transposase orfA
cmr|SAK_2000 Streptococcus agalactiae A909     IS1381, transposase orfA
cmr|SAL_1231 Streptococcus agalactiae 515     degenerate transposase (orf1)
cmr|SAM_1807 Streptococcus agalactiae CJB111     degenerate transposase (orf1)
cmr|SAM_1935 Streptococcus agalactiae CJB111     degenerate transposase (orf1)
dbj|BAE45251.1 Streptococcus agalactiae     putative transposase
fig|205921.3.peg.1082 Streptococcus agalactiae A909 FIG   IS1381, transposase OrfA
fig|205921.3.peg.1134 Streptococcus agalactiae A909 FIG   IS1381, transposase OrfA
fig|205921.3.peg.137 Streptococcus agalactiae A909 FIG   IS1381, transposase OrfA
fig|205921.3.peg.532 Streptococcus agalactiae A909 FIG   IS1381, transposase OrfA
fig|205921.3.peg.955 Streptococcus agalactiae A909 FIG   IS1381, transposase OrfA
fig|205921.4.peg.1002 Streptococcus agalactiae A909 FIG   IS1381, transposase OrfA
fig|205921.4.peg.139 Streptococcus agalactiae A909 FIG   IS1381, transposase OrfA
fig|205921.4.peg.1947 Streptococcus agalactiae A909 FIG   IS1381, transposase OrfA
fig|205921.4.peg.1978 Streptococcus agalactiae A909 FIG   IS1381, transposase OrfA
fig|205921.4.peg.463 Streptococcus agalactiae A909 FIG   IS1381, transposase OrfA
fig|208435.1.peg.1417 Streptococcus agalactiae 2603V/R FIG   IS1381, transposase OrfA
fig|208435.1.peg.1506 Streptococcus agalactiae 2603V/R FIG   IS1381, transposase OrfA
fig|208435.1.peg.1954 Streptococcus agalactiae 2603V/R FIG   IS1381, transposase OrfA
fig|208435.1.peg.261 Streptococcus agalactiae 2603V/R FIG   IS1381, transposase OrfA
fig|208435.1.peg.535 Streptococcus agalactiae 2603V/R FIG   IS1381, transposase OrfA
fig|208435.1.peg.941 Streptococcus agalactiae 2603V/R FIG   IS1381, transposase OrfA
fig|208435.3.peg.1466 Streptococcus agalactiae 2603V/R FIG   IS1381, transposase OrfA
fig|208435.3.peg.1558 Streptococcus agalactiae 2603V/R FIG   IS1381, transposase OrfA
fig|208435.3.peg.260 Streptococcus agalactiae 2603V/R FIG   IS1381, transposase OrfA
fig|208435.3.peg.971 Streptococcus agalactiae 2603V/R FIG   IS1381, transposase OrfA
fig|342613.5.peg.169 Streptococcus agalactiae 18RS21 FIG   IS1381, transposase OrfA
fig|342613.5.peg.363 Streptococcus agalactiae 18RS21 FIG   IS1381, transposase OrfA
fig|342613.5.peg.530 Streptococcus agalactiae 18RS21 FIG   IS1381, transposase OrfA
fig|342613.5.peg.992 Streptococcus agalactiae 18RS21 FIG   IS1381, transposase OrfA
fig|342614.4.peg.234 Streptococcus agalactiae 515 FIG   IS1381, transposase OrfA
fig|342615.4.peg.1408 Streptococcus agalactiae H36B FIG   IS1381, transposase OrfA
fig|342615.4.peg.156 Streptococcus agalactiae H36B FIG   IS1381, transposase OrfA
fig|342615.4.peg.1885 Streptococcus agalactiae H36B FIG   IS1381, transposase OrfA
fig|342615.4.peg.2129 Streptococcus agalactiae H36B FIG   IS1381, transposase OrfA
fig|342615.4.peg.666 Streptococcus agalactiae H36B FIG   IS1381, transposase OrfA
fig|342615.4.peg.748 Streptococcus agalactiae H36B FIG   IS1381, transposase OrfA
fig|342615.4.peg.761 Streptococcus agalactiae H36B FIG   IS1381, transposase OrfA
fig|342615.4.peg.885 Streptococcus agalactiae H36B FIG   IS1381, transposase OrfA
fig|342617.4.peg.1062 Streptococcus agalactiae CJB111 FIG   IS1381, transposase OrfA
fig|342617.4.peg.1488 Streptococcus agalactiae CJB111 FIG   IS1381, transposase OrfA
fig|342617.4.peg.426 Streptococcus agalactiae CJB111 FIG   IS1381, transposase OrfA
gb|AAM99169.1 Streptococcus agalactiae 2603V/R     IS1381, transposase OrfA
gb|AAM99443.1 Streptococcus agalactiae 2603V/R     IS1381, transposase OrfA
gb|AAM99849.1 Streptococcus agalactiae 2603V/R     IS1381, transposase OrfA
gb|AAN00326.1 Streptococcus agalactiae 2603V/R     IS1381, transposase OrfA
gb|AAN00415.1 Streptococcus agalactiae 2603V/R     IS1381, transposase OrfA
gb|AAN00863.1 Streptococcus agalactiae 2603V/R     IS1381, transposase OrfA
gb|AAT10382.1 Streptococcus agalactiae     putative transposase
gb|ABA44475.1 Streptococcus agalactiae A909     IS1381, transposase orfA
gb|ABA44857.1 Streptococcus agalactiae A909     IS1381, transposase orfA
gb|ABA45256.1 Streptococcus agalactiae A909     IS1381, transposase orfA
gb|ABA45558.1 Streptococcus agalactiae A909     IS1381, transposase orfA
gb|ABA46264.1 Streptococcus agalactiae A909     IS1381, transposase orfA
gb|ABD95571.1 Streptococcus agalactiae     transposase OrfA
gb|AE014203_16 Streptococcus agalactiae 2603V/R     IS1381, transposase OrfA
gb|AE014216_19 Streptococcus agalactiae 2603V/R     IS1381, transposase OrfA
gb|AE014236_3 Streptococcus agalactiae 2603V/R     IS1381, transposase OrfA
gb|AE014258_13 Streptococcus agalactiae 2603V/R     IS1381, transposase OrfA
gb|AE014262_20 Streptococcus agalactiae 2603V/R     IS1381, transposase OrfA
gb|AE014282_5 Streptococcus agalactiae 2603V/R     IS1381, transposase OrfA
gb|EAO62543.1 Streptococcus agalactiae 18RS21     degenerate transposase
gb|EAO62976.1 Streptococcus agalactiae 18RS21     degenerate transposase
gb|EAO63147.1 Streptococcus agalactiae 18RS21     degenerate transposase
gb|EAO63349.1 Streptococcus agalactiae 18RS21     degenerate transposase
gb|EAO72008.1 Streptococcus agalactiae 515     degenerate transposase (orf1)
gb|EAO72952.1 Streptococcus agalactiae CJB111     degenerate transposase (orf1)
gb|EAO73368.1 Streptococcus agalactiae CJB111     degenerate transposase (orf1)
gb|EAO77074.1 Streptococcus agalactiae H36B     degenerate transposase (orf1)
gb|EAO77335.1 Streptococcus agalactiae H36B     degenerate transposase (orf1)
gb|EAO77821.1 Streptococcus agalactiae H36B     degenerate transposase (orf1)
gb|EAO78317.1 Streptococcus agalactiae H36B     degenerate transposase (orf1)
gb|EAO78457.1 Streptococcus agalactiae H36B     degenerate transposase (orf1)
gb|EAO78539.1 Streptococcus agalactiae H36B     degenerate transposase (orf1)
gb|EAO79005.1 Streptococcus agalactiae H36B     degenerate transposase (orf1)
gi|22533275 Streptococcus agalactiae 2603V/R NCBI   IS1381, transposase OrfA
gi|22533562 Streptococcus agalactiae 2603V/R NCBI   IS1381, transposase OrfA
gi|22533988 Streptococcus agalactiae 2603V/R NCBI   IS1381, transposase OrfA
gi|22534486 Streptococcus agalactiae 2603V/R NCBI   IS1381, transposase OrfA
gi|22534579 Streptococcus agalactiae 2603V/R NCBI   IS1381, transposase OrfA
gi|22535047 Streptococcus agalactiae 2603V/R NCBI   IS1381, transposase OrfA
gi|22536446 Streptococcus agalactiae 2603V/R NCBI   IS1381 transposase protein A
gi|22536720 Streptococcus agalactiae 2603V/R NCBI   IS1381 transposase protein A
gi|22537126 Streptococcus agalactiae 2603V/R NCBI   IS1381 transposase protein A
gi|22537602 Streptococcus agalactiae 2603V/R NCBI   IS1381 transposase protein A
gi|22537691 Streptococcus agalactiae 2603V/R NCBI   IS1381 transposase protein A
gi|22538139 Streptococcus agalactiae 2603V/R NCBI   IS1381 transposase protein A
gi|47087866 Streptococcus agalactiae NCBI   putative transposase
gi|76150608 Streptococcus agalactiae NCBI   putative transposase
gi|76561891 Streptococcus agalactiae A909 NCBI   IS1381, transposase orfA
gi|76562273 Streptococcus agalactiae A909 NCBI   IS1381, transposase orfA
gi|76562672 Streptococcus agalactiae A909 NCBI   IS1381, transposase orfA
gi|76562974 Streptococcus agalactiae A909 NCBI   IS1381, transposase orfA
gi|76563680 Streptococcus agalactiae A909 NCBI   IS1381, transposase orfA
gi|76586011 Streptococcus agalactiae 18RS21 NCBI   degenerate transposase
gi|76586470 Streptococcus agalactiae 18RS21 NCBI   degenerate transposase
gi|76586647 Streptococcus agalactiae 18RS21 NCBI   degenerate transposase
gi|76586857 Streptococcus agalactiae 18RS21 NCBI   degenerate transposase
gi|76786834 Streptococcus agalactiae A909 NCBI   IS1381 transposase protein A
gi|76787216 Streptococcus agalactiae A909 NCBI   IS1381 transposase protein A
gi|76787615 Streptococcus agalactiae A909 NCBI   IS1381 transposase protein A
gi|76787917 Streptococcus agalactiae A909 NCBI   IS1381 transposase protein A
gi|76788623 Streptococcus agalactiae A909 NCBI   IS1381 transposase protein A
gi|76797781 Streptococcus agalactiae 18RS21 NCBI   degenerate transposase
gi|76798024 Streptococcus agalactiae 18RS21 NCBI   degenerate transposase
gi|76798162 Streptococcus agalactiae 18RS21 NCBI   degenerate transposase
gi|76798646 Streptococcus agalactiae 18RS21 NCBI   degenerate transposase
gi|77160899 Streptococcus agalactiae 515 NCBI   degenerate transposase (orf1)
gi|77161971 Streptococcus agalactiae CJB111 NCBI   degenerate transposase (orf1)
gi|77162400 Streptococcus agalactiae CJB111 NCBI   degenerate transposase (orf1)
gi|77174173 Streptococcus agalactiae H36B NCBI   degenerate transposase (orf1)
gi|77174490 Streptococcus agalactiae H36B NCBI   degenerate transposase (orf1)
gi|77175013 Streptococcus agalactiae H36B NCBI   degenerate transposase (orf1)
gi|77175531 Streptococcus agalactiae H36B NCBI   degenerate transposase (orf1)
gi|77175675 Streptococcus agalactiae H36B NCBI   degenerate transposase (orf1)
gi|77175759 Streptococcus agalactiae H36B NCBI   degenerate transposase (orf1)
gi|77176235 Streptococcus agalactiae H36B NCBI   degenerate transposase (orf1)
gi|77405092 Streptococcus agalactiae H36B NCBI   degenerate transposase (orf1)
gi|77405615 Streptococcus agalactiae H36B NCBI   degenerate transposase (orf1)
gi|77405679 Streptococcus agalactiae H36B NCBI   degenerate transposase (orf1)
gi|77405821 Streptococcus agalactiae H36B NCBI   degenerate transposase (orf1)
gi|77406389 Streptococcus agalactiae H36B NCBI   degenerate transposase (orf1)
gi|77406904 Streptococcus agalactiae H36B NCBI   degenerate transposase (orf1)
gi|77407218 Streptococcus agalactiae H36B NCBI   degenerate transposase (orf1)
gi|77411546 Streptococcus agalactiae CJB111 NCBI   degenerate transposase (orf1)
gi|77411945 Streptococcus agalactiae CJB111 NCBI   degenerate transposase (orf1)
gi|77413001 Streptococcus agalactiae 515 NCBI   degenerate transposase (orf1)
gi|90576981 Streptococcus agalactiae NCBI   transposase OrfA
img|637315455 Streptococcus agalactiae 2603V/R IMG   IS1381 transposase protein A
img|637315743 Streptococcus agalactiae 2603V/R IMG   IS1381 transposase protein A
img|637316150 Streptococcus agalactiae 2603V/R IMG   IS1381 transposase protein A
img|637316631 Streptococcus agalactiae 2603V/R IMG   IS1381 transposase protein A
img|637316720 Streptococcus agalactiae 2603V/R IMG   IS1381 transposase protein A
img|637317170 Streptococcus agalactiae 2603V/R IMG   IS1381 transposase protein A
img|637724550 Streptococcus agalactiae A909 IMG   IS1381 transposase protein A
img|637724894 Streptococcus agalactiae A909 IMG   IS1381 transposase protein A
img|637725404 Streptococcus agalactiae A909 IMG   IS1381 transposase protein A
img|637726292 Streptococcus agalactiae A909 IMG   IS1381 transposase protein A
img|637726321 Streptococcus agalactiae A909 IMG   IS1381 transposase protein A
img|638643201 Streptococcus agalactiae 18RS21 IMG   degenerate transposase
img|638643399 Streptococcus agalactiae 18RS21 IMG   degenerate transposase
img|638643562 Streptococcus agalactiae 18RS21 IMG   degenerate transposase
img|638644033 Streptococcus agalactiae 18RS21 IMG   degenerate transposase
img|638645685 Streptococcus agalactiae 515 IMG   degenerate transposase (orf1)
img|638648801 Streptococcus agalactiae CJB111 IMG   degenerate transposase (orf1)
img|638649232 Streptococcus agalactiae CJB111 IMG   degenerate transposase (orf1)
img|638652454 Streptococcus agalactiae H36B IMG   degenerate transposase (orf1)
img|638652958 Streptococcus agalactiae H36B IMG   degenerate transposase (orf1)
img|638653056 Streptococcus agalactiae H36B IMG   degenerate transposase (orf1)
img|638653178 Streptococcus agalactiae H36B IMG   degenerate transposase (orf1)
img|638653702 Streptococcus agalactiae H36B IMG   degenerate transposase (orf1)
img|638654178 Streptococcus agalactiae H36B IMG   degenerate transposase (orf1)
img|638654436 Streptococcus agalactiae H36B IMG   degenerate transposase (orf1)
kegg|sag:SAG0262 Streptococcus agalactiae 2603 (serotype V) KEGG   IS1381 transposase protein A
kegg|sag:SAG0542 Streptococcus agalactiae 2603 (serotype V) KEGG   IS1381 transposase protein A
kegg|sag:SAG0965 Streptococcus agalactiae 2603 (serotype V) KEGG   IS1381 transposase protein A
kegg|sag:SAG1458 Streptococcus agalactiae 2603 (serotype V) KEGG   IS1381 transposase protein A
kegg|sag:SAG1549 Streptococcus agalactiae 2603 (serotype V) KEGG   IS1381 transposase protein A
kegg|sag:SAG2003 Streptococcus agalactiae 2603 (serotype V) KEGG   IS1381 transposase protein A
kegg|sak:SAK_0191 Streptococcus agalactiae A909 (serotype Ia) KEGG   IS1381 transposase protein A
kegg|sak:SAK_0540 Streptococcus agalactiae A909 (serotype Ia) KEGG   IS1381 transposase protein A
kegg|sak:SAK_1060 Streptococcus agalactiae A909 (serotype Ia) KEGG   IS1381 transposase protein A
kegg|sak:SAK_1970 Streptococcus agalactiae A909 (serotype Ia) KEGG   IS1381 transposase protein A
kegg|sak:SAK_2000 Streptococcus agalactiae A909 (serotype Ia) KEGG   IS1381 transposase protein A
ref|NP_687297.1 Streptococcus agalactiae 2603V/R RefSeq   IS1381 transposase protein A
ref|NP_687571.1 Streptococcus agalactiae 2603V/R RefSeq   IS1381 transposase protein A
ref|NP_687977.1 Streptococcus agalactiae 2603V/R RefSeq   IS1381 transposase protein A
ref|NP_688453.1 Streptococcus agalactiae 2603V/R RefSeq   IS1381 transposase protein A
ref|NP_688542.1 Streptococcus agalactiae 2603V/R RefSeq   IS1381 transposase protein A
ref|NP_688990.1 Streptococcus agalactiae 2603V/R RefSeq   IS1381 transposase protein A
ref|YP_328864.1 Streptococcus agalactiae A909 RefSeq   IS1381 transposase protein A
ref|YP_329172.1 Streptococcus agalactiae A909 RefSeq   IS1381 transposase protein A
ref|YP_329681.1 Streptococcus agalactiae A909 RefSeq   IS1381 transposase protein A
ref|YP_330562.1 Streptococcus agalactiae A909 RefSeq   IS1381 transposase protein A
ref|YP_330591.1 Streptococcus agalactiae A909 RefSeq   IS1381 transposase protein A
ref|ZP_00780047.1 Streptococcus agalactiae 18RS21 RefSeq   degenerate transposase
ref|ZP_00780282.1 Streptococcus agalactiae 18RS21 RefSeq   degenerate transposase
ref|ZP_00780414.1 Streptococcus agalactiae 18RS21 RefSeq   degenerate transposase
ref|ZP_00780872.1 Streptococcus agalactiae 18RS21 RefSeq   degenerate transposase
ref|ZP_00782191.1 Streptococcus agalactiae H36B RefSeq   degenerate transposase (orf1)
ref|ZP_00782704.1 Streptococcus agalactiae H36B RefSeq   degenerate transposase (orf1)
ref|ZP_00782766.1 Streptococcus agalactiae H36B RefSeq   degenerate transposase (orf1)
ref|ZP_00782904.1 Streptococcus agalactiae H36B RefSeq   degenerate transposase (orf1)
ref|ZP_00783450.1 Streptococcus agalactiae H36B RefSeq   degenerate transposase (orf1)
ref|ZP_00783928.1 Streptococcus agalactiae H36B RefSeq   degenerate transposase (orf1)
ref|ZP_00784186.1 Streptococcus agalactiae H36B RefSeq   degenerate transposase (orf1)
ref|ZP_00787889.1 Streptococcus agalactiae CJB111 RefSeq   degenerate transposase (orf1)
ref|ZP_00788275.1 Streptococcus agalactiae CJB111 RefSeq   degenerate transposase (orf1)
ref|ZP_00789203.1 Streptococcus agalactiae 515 RefSeq   degenerate transposase (orf1)
tr|Q3D490 Streptococcus agalactiae H36B TrEMBL   Degenerate transposase (Orf1)
tr|Q3DEP3 Streptococcus agalactiae CJB111 TrEMBL   Degenerate transposase (Orf1)
tr|Q3DNK9 Streptococcus agalactiae 515 TrEMBL   Degenerate transposase (Orf1)
tr|Q3DUX5 Streptococcus agalactiae 18RS21 TrEMBL   Degenerate transposase
tr|Q3K2T1 Streptococcus agalactiae serotype Ia TrEMBL   IS1381, transposase orfA
tr|Q6J5L9 Streptococcus agalactiae TrEMBL   Putative transposase
tr|Q8CMB5 Streptococcus agalactiae serotype V TrEMBL   IS1381, transposase OrfA


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search