The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|208435.3.peg.536: Streptococcus agalactiae 2603V/R

This feature in The SEED Viewer

NCBI Taxonomy Id: 208435

Current Assignment: Chorismate mutase I (EC 5.4.99.5)
Translate Function Assignments



Context on contig NC_004116 from base 549006 to 560891 (11886 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
530 549006 550403 1398 +           Dipeptidase locus|SAG0534, protein_id|NP_687563.1, gi|22536712, geneID|1013337
531 550545 552065 1521 + 141         Candidate zinc-binding lipoprotein ZinT locus|SAG0535, protein_id|NP_687564.1, gi|22536713, geneID|1013338
532 552438 552178 261 - 112     3: 2 1 3   LSU ribosomal protein L31p @ LSU ribosomal protein L31p, zinc-independent gene_name|rpmE2, locus|SAG0536, protein_id|NP_687565.1, gi|22536714, geneID|1013339
533 553482 552547 936 - 108     2: 7 5   3'-to-5' oligoribonuclease A, Bacillus type locus|SAG0537, protein_id|NP_687566.1, gi|22536715, geneID|1013340
534 553748 554770 1023 + 265     3: 10 8 9   Adenosine deaminase (EC 3.5.4.4) locus|SAG0538, protein_id|NP_687567.1, gi|22536716, geneID|1013341
535 554829 555272 444 + 58     1: 16   Flavodoxin locus|SAG0539, protein_id|NP_687568.1, gi|22536717, geneID|1013342
536 555349 555624 276 + 76     5: 13 14 17 4 12   Chorismate mutase I (EC 5.4.99.5) locus|SAG0540, protein_id|NP_687569.1, gi|22536718, geneID|1013343
537 555617 556813 1197 + -8     1: 6   EriC-type fluoride/proton exchange protein locus|SAG0541, protein_id|NP_687570.1, gi|22536719, geneID|1013344
538 557266 557649 384 + 452         IS1381, transposase OrfA locus|SAG0542, protein_id|NP_687571.1, gi|22536720, geneID|1013345
539 557682 558071 390 + 32         Mobile element protein locus|SAG0543, protein_id|NP_687572.1, gi|22536721, geneID|1013346
540 558254 558601 348 + 182     4: 15 2 1 11   LSU ribosomal protein L19p gene_name|rplS, locus|SAG0544, protein_id|NP_687573.1, gi|22536722, geneID|1013347
rna.91 558712 558783 72 + 110         tRNA-Arg-CCT  
541 559905 558826 1080 - 42         Integrase locus|SAG0545, protein_id|NP_687574.1, gi|22536723, geneID|1013349
542 560092 559910 183 - 4         hypothetical protein  
543 560891 560334 558 - 241         hypothetical protein locus|SAG0547, protein_id|NP_687576.1, gi|22536725, geneID|1013351

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
Chorismate_Synthesis VeronikaV Chorismate mutase I (EC 5.4.99.5)
Phenylalanine_and_Tyrosine_Branches_from_Chorismate carolb Chorismate mutase I (EC 5.4.99.5)
Major_Facilitator_Transporter Blaby_Crysten_user Chorismate mutase I (EC 5.4.99.5)
DUF2156 vcrecy Chorismate mutase I (EC 5.4.99.5)
Phenylalanine_and_Tyrosine_biosynthesis_PanGenomes Acharya_Geeta_user Chorismate mutase I (EC 5.4.99.5)


  Protein Sequence

>fig|208435.3.peg.536 Chorismate mutase I (EC 5.4.99.5)
MELEEIRQEIDEIDQQLVSLLETRMGLILEVIAFKKKHRLPVLDNNRENEVLNNVLKKVQ
NHQFDDVIRATFKDIMTESRVYQKENIVDGD

MD5 = e91c383b31bb2c631948b6817f788562


  DNA Sequence

>fig|208435.3.peg.536 Chorismate mutase I (EC 5.4.99.5)
atggaattagaagagattcgtcaagaaatagatgaaatagatcagcaattagtaagcctt
ttagaaactagaatgggtctaattttagaggtcatagcatttaaaaagaaacatcgactt
ccagttttagataataatcgtgaaaacgaagtgcttaacaatgtattgaagaaagtccaa
aaccatcaatttgacgatgtgatacgagcaactttcaaagacattatgacagaatctcgt
gtttatcaaaaggagaatattgtagacggtgattaa


  DNA with Flanking Sequence

>fig|208435.3.peg.536 Chorismate mutase I (EC 5.4.99.5)
ttatgctagcatgaccggaaatactgaagaaattgctgacattgttgctgataaattacg
tgacttgggtctagatgttgaagtagaagagtgtacgatggttgatgctgcagattttga
agatgctgacattgcaattgttgccacttatacatatggtgatggagatttaccagatga
aatcgtggacttttatgaagatttagcagaggttgatttatctggtaaagtttacggcgt
agtgggttcaggtgatactttctatgattacttctgcaaatctgttgatgagttcgaggc
tcaattcgcattaacaggagcacaaaaaggtgctgattgtgttaaagttgatttagcggc
agaagacgaagacattgaaaacttagaagcttttgctgaagaaattgcttctaaacttaa
ctaagctaccaaaaagacgaacacgagtcgtctttttaacttttttaccatcttttgtaa
ctagaatatgagatatagatatggaattagaagagattcgtcaagaaatagatgaaatag
atcagcaattagtaagccttttagaaactagaatgggtctaattttagaggtcatagcat
ttaaaaagaaacatcgacttccagttttagataataatcgtgaaaacgaagtgcttaaca
atgtattgaagaaagtccaaaaccatcaatttgacgatgtgatacgagcaactttcaaag
acattatgacagaatctcgtgtttatcaaaaggagaatattgtagacggtgattaaacga
tttgataattatgctcagtacgtacttgttttaggttttagcttactaattggtggtgtg
gttggggctattacagcagtctttggacgtgttctattattcctgacagcctttagaagt
gattatatagcttacctactcccttttcttagcattgttggtttatttatagtttttgtc
tatcaaaaatttgggggtaagagtgttaaagggatgggattggtatttgaagtaggtcat
ggtaatgaggagactattccgaaacgtcttgttcctctcgtgatattaacaacttggtta
acccacttatttggtggtagtgcaggtcgtgagggggttgctgtacagattggggctacc
gtttcacactactttcaaaaatattgccgtttacaaaacgcttctcaacttttcctagta
atgggaatggcagcaggttttgctggtttatttcagactcctttagctgctacttttttt
gcgattgaagttttgg


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0004106       F:chorismate mutase activity
GO:0009073       P:aromatic amino acid family biosynthetic pro...
cmr|NT04SA0693 Streptococcus agalactiae NEM316     chorismate mutase
cmr|SAG_0540 Streptococcus agalactiae 2603V/R     chorismate mutase, putative
cmr|SAI_0667 Streptococcus agalactiae H36B     chorismate mutase
cmr|SAJ_0658 Streptococcus agalactiae 18RS21     chorismate mutase
cmr|SAK_0690 Streptococcus agalactiae A909     chorismate mutase
cmr|SAL_0608 Streptococcus agalactiae 515     chorismate mutase
cmr|SAN_0647 Streptococcus agalactiae COH1     chorismate mutase
emb|CAD46229.1 Streptococcus agalactiae NEM316 EMBL   Unknown
fig|205921.3.peg.732 Streptococcus agalactiae A909 FIG   Chorismate mutase I (EC 5.4.99.5)
fig|205921.4.peg.620 Streptococcus agalactiae A909 FIG   Chorismate mutase I (EC 5.4.99.5)
fig|208435.1.peg.533 Streptococcus agalactiae 2603V/R FIG   Chorismate mutase I (EC 5.4.99.5)
fig|211110.1.peg.579 Streptococcus agalactiae NEM316 FIG   Chorismate mutase I (EC 5.4.99.5)
fig|211110.3.peg.601 Streptococcus agalactiae NEM316 FIG   Chorismate mutase I (EC 5.4.99.5)
fig|342613.5.peg.749 Streptococcus agalactiae 18RS21 FIG   Chorismate mutase I (EC 5.4.99.5)
fig|342614.4.peg.2124 Streptococcus agalactiae 515 FIG   Chorismate mutase I (EC 5.4.99.5)
fig|342615.4.peg.1744 Streptococcus agalactiae H36B FIG   Chorismate mutase I (EC 5.4.99.5)
fig|342616.4.peg.830 Streptococcus agalactiae COH1 FIG   Chorismate mutase I (EC 5.4.99.5)
gb|AAM99441.1 Streptococcus agalactiae 2603V/R     chorismate mutase, putative
gb|ABA45469.1 Streptococcus agalactiae A909     chorismate mutase
gb|AE014216_17 Streptococcus agalactiae 2603V/R     chorismate mutase, putative
gb|EAO62777.1 Streptococcus agalactiae 18RS21     chorismate mutase
gb|EAO70066.1 Streptococcus agalactiae 515     chorismate mutase
gb|EAO75987.1 Streptococcus agalactiae COH1     chorismate mutase
gb|EAO77475.1 Streptococcus agalactiae H36B     chorismate mutase
gi|22533560 Streptococcus agalactiae 2603V/R NCBI   chorismate mutase, putative
gi|22536718 Streptococcus agalactiae 2603V/R NCBI   hypothetical protein SAG0540
gi|23095008 Streptococcus agalactiae NEM316 NCBI   Unknown
gi|25010654 Streptococcus agalactiae NEM316 NCBI   hypothetical protein gbs0585
gi|76562885 Streptococcus agalactiae A909 NCBI   chorismate mutase
gi|76586261 Streptococcus agalactiae 18RS21 NCBI   chorismate mutase
gi|76787828 Streptococcus agalactiae A909 NCBI   hypothetical protein SAK_0690
gi|76798389 Streptococcus agalactiae 18RS21 NCBI   chorismate mutase
gi|77158766 Streptococcus agalactiae 515 NCBI   chorismate mutase
gi|77172855 Streptococcus agalactiae COH1 NCBI   chorismate mutase
gi|77174642 Streptococcus agalactiae H36B NCBI   chorismate mutase
gi|77406765 Streptococcus agalactiae H36B NCBI   chorismate mutase
gi|77408498 Streptococcus agalactiae COH1 NCBI   chorismate mutase
gi|77415182 Streptococcus agalactiae 515 NCBI   chorismate mutase
img|637315741 Streptococcus agalactiae 2603V/R IMG   chorismate mutase, putative
img|637349319 Streptococcus agalactiae NEM316 IMG   hypothetical protein
img|637725043 Streptococcus agalactiae A909 IMG   chorismate mutase( EC:5.4.99.5 )
img|638643778 Streptococcus agalactiae 18RS21 IMG   chorismate mutase( EC:5.4.99.5 )
img|638647647 Streptococcus agalactiae 515 IMG   chorismate mutase( EC:5.4.99.5 )
img|638650749 Streptococcus agalactiae COH1 IMG   chorismate mutase( EC:5.4.99.5 )
img|638654037 Streptococcus agalactiae H36B IMG   chorismate mutase( EC:5.4.99.5 )
kegg|sag:SAG0540 Streptococcus agalactiae 2603 (serotype V) KEGG   hypothetical protein
kegg|sak:SAK_0690 Streptococcus agalactiae A909 (serotype Ia) KEGG   hypothetical protein (EC:5.4.99.5)
kegg|san:gbs0585 Streptococcus agalactiae NEM316 (serotype III) KEGG   hypothetical protein
ref|NP_687569.1 Streptococcus agalactiae 2603V/R RefSeq   hypothetical protein SAG0540
ref|NP_735049.1 Streptococcus agalactiae NEM316 RefSeq   hypothetical protein gbs0585
ref|YP_329321.1 Streptococcus agalactiae A909 RefSeq   hypothetical protein SAK_0690
ref|ZP_00780631.1 Streptococcus agalactiae 18RS21 RefSeq   chorismate mutase
ref|ZP_00783801.1 Streptococcus agalactiae H36B RefSeq   chorismate mutase
ref|ZP_00785235.1 Streptococcus agalactiae COH1 RefSeq   chorismate mutase
ref|ZP_00791193.1 Streptococcus agalactiae 515 RefSeq   chorismate mutase
tr|Q3CZQ7 Streptococcus agalactiae H36B TrEMBL   Chorismate mutase
tr|Q3D945 Streptococcus agalactiae COH1 TrEMBL   Chorismate mutase
tr|Q3DHZ7 Streptococcus agalactiae 515 TrEMBL   Chorismate mutase
tr|Q3DTB0 Streptococcus agalactiae 18RS21 TrEMBL   Chorismate mutase
tr|Q3K2D2 Streptococcus agalactiae serotype Ia TrEMBL   Chorismate mutase
tr|Q8E123 Streptococcus agalactiae serotype V TrEMBL   Chorismate mutase, putative
tr|Q8E6H8 Streptococcus agalactiae serotype III TrEMBL   Putative uncharacterized protein gbs0585


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search