The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|208435.3.peg.535: Streptococcus agalactiae 2603V/R

This feature in The SEED Viewer

NCBI Taxonomy Id: 208435

Current Assignment: Flavodoxin
Translate Function Assignments



Context on contig NC_004116 from base 549006 to 560092 (11087 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
530 549006 550403 1398 +           Dipeptidase locus|SAG0534, protein_id|NP_687563.1, gi|22536712, geneID|1013337
531 550545 552065 1521 + 141         Candidate zinc-binding lipoprotein ZinT locus|SAG0535, protein_id|NP_687564.1, gi|22536713, geneID|1013338
532 552438 552178 261 - 112     3: 2 1 3   LSU ribosomal protein L31p @ LSU ribosomal protein L31p, zinc-independent gene_name|rpmE2, locus|SAG0536, protein_id|NP_687565.1, gi|22536714, geneID|1013339
533 553482 552547 936 - 108     2: 7 5   3'-to-5' oligoribonuclease A, Bacillus type locus|SAG0537, protein_id|NP_687566.1, gi|22536715, geneID|1013340
534 553748 554770 1023 + 265     3: 10 8 9   Adenosine deaminase (EC 3.5.4.4) locus|SAG0538, protein_id|NP_687567.1, gi|22536716, geneID|1013341
535 554829 555272 444 + 58     1: 16   Flavodoxin locus|SAG0539, protein_id|NP_687568.1, gi|22536717, geneID|1013342
536 555349 555624 276 + 76     5: 13 14 17 4 12   Chorismate mutase I (EC 5.4.99.5) locus|SAG0540, protein_id|NP_687569.1, gi|22536718, geneID|1013343
537 555617 556813 1197 + -8     1: 6   EriC-type fluoride/proton exchange protein locus|SAG0541, protein_id|NP_687570.1, gi|22536719, geneID|1013344
538 557266 557649 384 + 452         IS1381, transposase OrfA locus|SAG0542, protein_id|NP_687571.1, gi|22536720, geneID|1013345
539 557682 558071 390 + 32         Mobile element protein locus|SAG0543, protein_id|NP_687572.1, gi|22536721, geneID|1013346
540 558254 558601 348 + 182     4: 15 2 1 11   LSU ribosomal protein L19p gene_name|rplS, locus|SAG0544, protein_id|NP_687573.1, gi|22536722, geneID|1013347
rna.91 558712 558783 72 + 110         tRNA-Arg-CCT  
541 559905 558826 1080 - 42         Integrase locus|SAG0545, protein_id|NP_687574.1, gi|22536723, geneID|1013349
542 560092 559910 183 - 4         hypothetical protein  

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
Flavodoxin gjo Flavodoxin


  Protein Sequence

>fig|208435.3.peg.535 Flavodoxin
MALAKIVYASMTGNTEEIADIVADKLRDLGLDVEVEECTMVDAADFEDADIAIVATYTYG
DGDLPDEIVDFYEDLAEVDLSGKVYGVVGSGDTFYDYFCKSVDEFEAQFALTGAQKGADC
VKVDLAAEDEDIENLEAFAEEIASKLN

MD5 = 3db1610cd865afd885a89eba59282bf1


  DNA Sequence

>fig|208435.3.peg.535 Flavodoxin
atggctttagcaaagattgtttatgctagcatgaccggaaatactgaagaaattgctgac
attgttgctgataaattacgtgacttgggtctagatgttgaagtagaagagtgtacgatg
gttgatgctgcagattttgaagatgctgacattgcaattgttgccacttatacatatggt
gatggagatttaccagatgaaatcgtggacttttatgaagatttagcagaggttgattta
tctggtaaagtttacggcgtagtgggttcaggtgatactttctatgattacttctgcaaa
tctgttgatgagttcgaggctcaattcgcattaacaggagcacaaaaaggtgctgattgt
gttaaagttgatttagcggcagaagacgaagacattgaaaacttagaagcttttgctgaa
gaaattgcttctaaacttaactaa


  DNA with Flanking Sequence

>fig|208435.3.peg.535 Flavodoxin
cccgatgactttacatgcaggtgagtgtggttgtgctaagcatattgcggatagtttaaa
tttagggattaagcgtatgggacatgtgacagctttaacaggacagagggatttaataaa
gcgatttgtcgaagaagatgctgtagcagagatgtgtttaactagcaatttacaaacaaa
agcagcctcaagtattcaaagttttccttatcaagaactttatgatgctggaggtaagat
tacaattaatacagataatcgtactgtttccgatacaaatttgacgaaagaatatagtct
tttcgtaacttattttggaacgaaaatagaagactttcttgttttcaatcaaaacgctgt
gaaggcctcctttacaagtgattcagagaaagatactttactacataagctacaagaaaa
ctatgacagctatctaaaataaccttcacgattctttaaaaatatgatagaatagtggta
atttacaagtggaggaagatatggctttagcaaagattgtttatgctagcatgaccggaa
atactgaagaaattgctgacattgttgctgataaattacgtgacttgggtctagatgttg
aagtagaagagtgtacgatggttgatgctgcagattttgaagatgctgacattgcaattg
ttgccacttatacatatggtgatggagatttaccagatgaaatcgtggacttttatgaag
atttagcagaggttgatttatctggtaaagtttacggcgtagtgggttcaggtgatactt
tctatgattacttctgcaaatctgttgatgagttcgaggctcaattcgcattaacaggag
cacaaaaaggtgctgattgtgttaaagttgatttagcggcagaagacgaagacattgaaa
acttagaagcttttgctgaagaaattgcttctaaacttaactaagctaccaaaaagacga
acacgagtcgtctttttaacttttttaccatcttttgtaactagaatatgagatatagat
atggaattagaagagattcgtcaagaaatagatgaaatagatcagcaattagtaagcctt
ttagaaactagaatgggtctaattttagaggtcatagcatttaaaaagaaacatcgactt
ccagttttagataataatcgtgaaaacgaagtgcttaacaatgtattgaagaaagtccaa
aaccatcaatttgacgatgtgatacgagcaactttcaaagacattatgacagaatctcgt
gtttatcaaaaggagaatattgtagacggtgattaaacgatttgataattatgctcagta
cgtacttgttttaggttttagcttactaattggtggtgtggttggggctattacagcagt
ctttggacgtgttctattattcctgacagcctttagaagtgattatatagcttacctact
ccct


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0005506       F:iron ion binding
GO:0009055       F:electron carrier activity
GO:0010181       F:FMN binding
GO:0016491       F:oxidoreductase activity
cmr|NT04SA0692 Streptococcus agalactiae NEM316     flavodoxin
cmr|SAG_0539 Streptococcus agalactiae 2603V/R     flavodoxin
cmr|SAJ_0657 Streptococcus agalactiae 18RS21     flavodoxin
cmr|SAK_0689 Streptococcus agalactiae A909     flavodoxin
cmr|SAM_0564 Streptococcus agalactiae CJB111     flavodoxin
cmr|SAN_0646 Streptococcus agalactiae COH1     flavodoxin
emb|CAD46228.1 Streptococcus agalactiae NEM316 EMBL   Unknown
fig|205921.3.peg.750 Streptococcus agalactiae A909 FIG   Flavodoxin
fig|205921.4.peg.619 Streptococcus agalactiae A909 FIG   Flavodoxin
fig|208435.1.peg.532 Streptococcus agalactiae 2603V/R FIG   Flavodoxin
fig|211110.1.peg.578 Streptococcus agalactiae NEM316 FIG   Flavodoxin
fig|211110.3.peg.600 Streptococcus agalactiae NEM316 FIG   Flavodoxin
fig|342613.5.peg.748 Streptococcus agalactiae 18RS21 FIG   Flavodoxin
fig|342616.4.peg.829 Streptococcus agalactiae COH1 FIG   Flavodoxin
fig|342617.4.peg.1094 Streptococcus agalactiae CJB111 FIG   Flavodoxin
gb|AAM99440.1 Streptococcus agalactiae 2603V/R     flavodoxin
gb|ABA44674.1 Streptococcus agalactiae A909     flavodoxin
gb|AE014216_16 Streptococcus agalactiae 2603V/R     flavodoxin
gb|EAO62775.1 Streptococcus agalactiae 18RS21     flavodoxin
gb|EAO73329.1 Streptococcus agalactiae CJB111     flavodoxin
gb|EAO76009.1 Streptococcus agalactiae COH1     flavodoxin
gi|22533559 Streptococcus agalactiae 2603V/R NCBI   flavodoxin
gi|22536717 Streptococcus agalactiae 2603V/R NCBI   flavodoxin
gi|23095007 Streptococcus agalactiae NEM316 NCBI   Unknown
gi|25010653 Streptococcus agalactiae NEM316 NCBI   flavodoxin
gi|76562090 Streptococcus agalactiae A909 NCBI   flavodoxin
gi|76586259 Streptococcus agalactiae 18RS21 NCBI   flavodoxin
gi|76787033 Streptococcus agalactiae A909 NCBI   flavodoxin
gi|76798387 Streptococcus agalactiae 18RS21 NCBI   flavodoxin
gi|77162360 Streptococcus agalactiae CJB111 NCBI   flavodoxin
gi|77172877 Streptococcus agalactiae COH1 NCBI   flavodoxin
gi|77408520 Streptococcus agalactiae COH1 NCBI   flavodoxin
gi|77411575 Streptococcus agalactiae CJB111 NCBI   flavodoxin
img|637315740 Streptococcus agalactiae 2603V/R IMG   flavodoxin
img|637349318 Streptococcus agalactiae NEM316 IMG   flavodoxin
img|637725042 Streptococcus agalactiae A909 IMG   flavodoxin
img|638643777 Streptococcus agalactiae 18RS21 IMG   flavodoxin
img|638648835 Streptococcus agalactiae CJB111 IMG   flavodoxin
img|638650748 Streptococcus agalactiae COH1 IMG   flavodoxin
kegg|sag:SAG0539 Streptococcus agalactiae 2603 (serotype V) KEGG   flavodoxin
kegg|sak:SAK_0689 Streptococcus agalactiae A909 (serotype Ia) KEGG   flavodoxin
kegg|san:gbs0584 Streptococcus agalactiae NEM316 (serotype III) KEGG   flavodoxin
ref|NP_687568.1 Streptococcus agalactiae 2603V/R RefSeq   flavodoxin
ref|NP_735048.1 Streptococcus agalactiae NEM316 RefSeq   flavodoxin
ref|YP_329320.1 Streptococcus agalactiae A909 RefSeq   flavodoxin
ref|ZP_00780629.1 Streptococcus agalactiae 18RS21 RefSeq   flavodoxin
ref|ZP_00785257.1 Streptococcus agalactiae COH1 RefSeq   flavodoxin
ref|ZP_00787917.1 Streptococcus agalactiae CJB111 RefSeq   flavodoxin
tr|Q3D946 Streptococcus agalactiae COH1 TrEMBL   Flavodoxin
tr|Q3DEK9 Streptococcus agalactiae CJB111 TrEMBL   Flavodoxin
tr|Q3DTB1 Streptococcus agalactiae 18RS21 TrEMBL   Flavodoxin
tr|Q3K2D3 Streptococcus agalactiae serotype Ia TrEMBL   Flavodoxin
tr|Q8E124 Streptococcus agalactiae serotype V TrEMBL   Flavodoxin
tr|Q8E6H9 Streptococcus agalactiae serotype III TrEMBL   Putative uncharacterized protein gbs0584


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search