The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|203120.4.peg.1624: Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293

This feature in The SEED Viewer

NCBI Taxonomy Id: 203120

Current Assignment: Phage replication initiation protein
Translate Function Assignments



Context on contig NC_008531 from base 1621770 to 1666960 (45191 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
pp.1 1621770 1666960 45191 +           Prophage 1. Evidence: 62 nt repeat confirmed by Ramy; attL: fig|203120.4.att.1; attR: fig|203120.4.att.2  
1618 1652770 1652192 579 - -14769     1: 1   hypothetical protein LEUM_1661, YP_819126.1, gi|116618755, GeneID:4423391
1619 1654171 1653731 441 - 960     1: 1   hypothetical protein LEUM_1664, YP_819129.1, gi|116618758, GeneID:4423394
1620 1654572 1654174 399 - 2         Protein gp63 [Bacteriophage A118] LEUM_1665, YP_819130.1, gi|116618759, GeneID:4423395
1621 1655798 1655094 705 - 521     1: 1   Phage phi 11 orf14 protein homolog LEUM_1668, YP_819133.1, gi|116618762, GeneID:4423398
1622 1655974 1655798 177 - -1     1: 1   hypothetical protein LEUM_1669, YP_819134.1, gi|116618763, GeneID:4423399
1623 1656903 1656130 774 - 155     1: 3 ff
idu(2)
ilit(
7773414)
Phage DNA helicase loader LEUM_1671, YP_819136.1, gi|116618765, GeneID:4423908
1624 1657799 1656900 900 - -4         Phage replication initiation protein LEUM_1672, YP_819137.1, gi|116618766, GeneID:4423909
1625 1658529 1657873 657 - 73     1: 1   hypothetical protein LEUM_1673, YP_819138.1, gi|116618767, GeneID:4423910
1626 1659452 1658508 945 - -22     1: 2 ff
isu
Phage recombination protein Bet LEUM_1674, YP_819139.1, gi|116618768, GeneID:4423911
1627 1659781 1659443 339 - -10     1: 1   hypothetical protein LEUM_1675, YP_819140.1, gi|116618769, GeneID:4423912
1628 1660206 1660433 228 + 424     1: 1   hypothetical protein LEUM_1677, YP_819142.1, gi|116618771, GeneID:4423914
1629 1660587 1660420 168 - -14     1: 1   hypothetical protein LEUM_1678, YP_819143.1, gi|116618772, GeneID:4423915
1630 1660763 1660599 165 - 11     1: 1   hypothetical protein LEUM_1679, YP_819144.1, gi|116618773, GeneID:4423916
1631 1661536 1660775 762 - 11         Phage antirepressor protein LEUM_1680, YP_819145.1, gi|116618774, GeneID:4423917
1632 1661742 1661500 243 - -37     1: 1   hypothetical protein LEUM_1681, YP_819146.1, gi|116618775, GeneID:4423918
1633 1661811 1662020 210 + 68     1: 1   hypothetical protein LEUM_1682, YP_819147.1, gi|116618776, GeneID:4423919
1634 1662144 1661998 147 - -23     1: 1   hypothetical protein LEUM_1683, YP_819148.1, gi|116618777, GeneID:4423920
1635 1662376 1662161 216 - 16     1: 1   hypothetical protein LEUM_1684, YP_819149.1, gi|116618778, GeneID:4423921
1636 1662426 1662767 342 + 49     1: 1   hypothetical protein LEUM_1685, YP_819150.1, gi|116618779, GeneID:4423922
1637 1662845 1662744 102 - -24     1: 1   hypothetical protein  

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|203120.4.peg.1624 Phage replication initiation protein
MFIRMMTMWRNHTKGCEAQRRNMADNKQEEKRYFWIKIRQDFFTDPYIKLLRRMAGGDTY
TIIYLKMLVKSADTNGTIYFQGAGQDLAEELSLMLDEGVEDVRALLAYLEAKKLILHPDF
TEDIYLVATPDLTGSETGSAKRVREFRARQKQKTLQSNSDVTTCYDSKSKSKSKNIELEQ
ELDTEKDTPYSKIVSLFENNGFGSVGGITSQNIQDELRDFADNSDVDEATRILEKAIEIA
VNNGKNSFSYVWGITKRWYNSGIFTIEALEAEEKKRTFSKGYGNTAKKEKIENGGYGTR

MD5 = 391e4969c6979ba39c0f0c839e21866a


  DNA Sequence

>fig|203120.4.peg.1624 Phage replication initiation protein
atgttcattcgtatgatgacgatgtggcgtaaccacacgaaagggtgtgaagcccaaagg
agaaacatggcagataacaaacaggaagaaaagcgatatttttggataaaaattcggcag
gatttcttcactgacccttatattaaattacttagaagaatggctggtggagacacctat
acaattatttatttaaaaatgctagtcaagagcgctgatacaaacggcactatttatttc
caaggtgcagggcaagatttagcagaagagttgtctctgatgttagatgaaggtgtagaa
gatgtgcgagcattactagcctacttagaagccaaaaaattaatattacacccagatttt
acagaggatatttatttagttgcaacgcctgatttgacaggttctgaaacgggttcagct
aaaagagttcgagaatttagagcacgacaaaaacaaaaaacgttacaaagtaacagtgat
gtaacaacctgttacgacagtaagagtaagagtaagagtaagaacatagagttagaacaa
gagttagacacagagaaagatacgccgtactcaaaaatagtatcactgtttgagaataac
ggttttggttctgttggtggtattacttcacaaaatattcaagatgagttaagagacttt
gctgataattcagatgttgatgaagcaactagaatattggaaaaagctattgaaattgca
gtcaataatggaaaaaattctttctcatacgtttggggtattacaaaacgttggtataac
agcggtattttcactattgaagcattggaagcggaagaaaaaaagcgaacttttagcaaa
ggatatggaaacacagctaagaaagaaaagattgaaaacggaggttatggaacaagatga


  DNA with Flanking Sequence

>fig|203120.4.peg.1624 Phage replication initiation protein
caatggcgggttattcgctgttaaggatactgctgattcaattattgaggatattacgga
agaacaaaatacgtggaatgttggccgtctaaagcaattacaaccagtgttgcaaaaaga
aattgatgaacgtaatgaatcgtatcaacttaaaacaccattgaccattaaggctgactg
gttaaagattagtaatttcactgctactggtaaaccaactggagcgctaacgaagttatt
gaatctagagtttgttcaagccaaagcattggaatctgaaccacccaagttaacagaagt
tcaggaagtaaaaaaagcgattaaatatgagttctcgaaagtttgggacgatattcaaga
tgacgacatttacaccggtaaagatttcaaacaaatgctttctgaaatcgccaaacaatt
aaattaaggtcgatatgacccgatcatcgtcactaaactgattaacccagtgaaaagagt
ttaagtcgctcgattcgttgatgttcattcgtatgatgacgatgtggcgtaaccacacga
aagggtgtgaagcccaaaggagaaacatggcagataacaaacaggaagaaaagcgatatt
tttggataaaaattcggcaggatttcttcactgacccttatattaaattacttagaagaa
tggctggtggagacacctatacaattatttatttaaaaatgctagtcaagagcgctgata
caaacggcactatttatttccaaggtgcagggcaagatttagcagaagagttgtctctga
tgttagatgaaggtgtagaagatgtgcgagcattactagcctacttagaagccaaaaaat
taatattacacccagattttacagaggatatttatttagttgcaacgcctgatttgacag
gttctgaaacgggttcagctaaaagagttcgagaatttagagcacgacaaaaacaaaaaa
cgttacaaagtaacagtgatgtaacaacctgttacgacagtaagagtaagagtaagagta
agaacatagagttagaacaagagttagacacagagaaagatacgccgtactcaaaaatag
tatcactgtttgagaataacggttttggttctgttggtggtattacttcacaaaatattc
aagatgagttaagagactttgctgataattcagatgttgatgaagcaactagaatattgg
aaaaagctattgaaattgcagtcaataatggaaaaaattctttctcatacgtttggggta
ttacaaaacgttggtataacagcggtattttcactattgaagcattggaagcggaagaaa
aaaagcgaacttttagcaaaggatatggaaacacagctaagaaagaaaagattgaaaacg
gaggttatggaacaagatgaatagcctcaaggaaatgttagaaaacgatgaacgatttgc
caagaacaaggttagcgatgaagaattgcaagcatggcgtgaaaaagtagaacgtgaaga
ccaggaacgagttcgtcaagcactgtttaataacagggcacgtatctacaagcgagatag
cgtgtggggaactagcggtgagcagacgttcacatttcagaagtggaacccaaaagtgca
acctaatcaaaagttagcccatgacatttggaaaaagtcagcagatatcactaagagaat
gtttgatagtaatttcaacgttctgttctacggtgaagctggtactggtaaaacagccat
ggtgttagcaatcattgatgcactgaaacaacactcgaataagttgagtatgtttgtcag
cgttatggacttacgagaactgattatgtatgacttcaatgacaatgaagcagctatcaa
gataaaaaacattgagcgatcaatgcgtgaagttgatgtg


  Assignments for Essentially Identical Proteins

No essentially identical proteins found

  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search