The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|196164.6.peg.853: Corynebacterium efficiens YS-314

This feature in The SEED Viewer

NCBI Taxonomy Id: 196164

Current Assignment: FIG00548751: hypothetical protein
Translate Function Assignments



Context on contig NC_004369 from base 881988 to 893345 (11358 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
848 881988 882272 285 +           FIG00549153: hypothetical protein locus|CE0830, protein_id|NP_737440.1, gi|25027386, geneID|1032936
849 882313 882477 165 + 40         hypothetical protein  
850 882477 882776 300 + -1         hypothetical protein locus|CE0831, protein_id|NP_737441.1, gi|25027387, geneID|1032937
851 883684 884085 402 + 907         hypothetical protein locus|CE0834, protein_id|NP_737444.1, gi|25027390, geneID|1032940
852 885062 886327 1266 + 976         hypothetical protein locus|CE0837, protein_id|NP_737447.1, gi|25027393, geneID|1032943
853 887066 888274 1209 + 738         FIG00548751: hypothetical protein locus|CE0839, protein_id|NP_737449.1, gi|25027395, geneID|1032945
854 888811 890346 1536 + 536         phage terminase, large subunit, putative locus|CE0841, protein_id|NP_737451.1, gi|25027397, geneID|1032947
855 890502 891662 1161 + 155         FIG00547189: hypothetical protein locus|CE0842, protein_id|NP_737452.1, gi|25027398, geneID|1032948
856 891659 892948 1290 + -4         FIG00549531: hypothetical protein locus|CE0843, protein_id|NP_737453.1, gi|25027399, geneID|1032949
857 892953 893345 393 + 4         hypothetical protein locus|CE0844, protein_id|NP_737454.1, gi|25027400, geneID|1032950

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|196164.6.peg.853 FIG00548751: hypothetical protein
MATVAKPGDLRFDSDALTNTLTGKPPAKHSHAAAVKKVSKSAREAGIEEALKLVATRDVW
IIHSNLSAELERKYRAYGARFVVIDPGEAVALERCAAGRPGYRKNQVASWYARRHSWPHD
AEIITSFDPATAGVDEDDIEVSGGRATLHVVTGPPAAGKSTFVREHARLGDVVLDYDLLA
NALAGEPADNHEHTRQIKAVTKAARLAALEAAMKQDITVWLIHSTPAASTLSRYESMGAT
VHVVDPGKDVVMKRVKQMRPRVMLPVAAAWYDKQPAVATPKTTTERGLGWDHQKQRANLV
AVHVDGTPCWWCGRPMFYDKTRNFDGLPLAADHEDARANGGDRANRLLHFSCNSSRQAGA
RDDQRPALNHSEPPTEPTAPPQATPAASVFAWPDLEPSRAGP

MD5 = 230c7c977d93d3e1761c6c3de2b54431


  DNA Sequence

>fig|196164.6.peg.853 FIG00548751: hypothetical protein
gtggccaccgtcgcgaagccgggtgatctacggtttgattctgatgcgctgaccaacacc
ctgacgggtaagcctccggcgaagcattcgcatgcggctgcggtgaagaaggtgtcgaag
tccgctcgtgaggcgggtattgaagaagcattgaagttggtggccacgcgcgatgtgtgg
atcattcactcgaatctctcggctgaactcgagcggaagtaccgggcatatggtgctcgg
tttgtggtgattgaccccggtgaggctgtggccttggaacggtgtgctgctggtcgccct
gggtatcggaagaatcaggtggcctcctggtacgcgcgtcggcattcgtggccacatgat
gcggagatcatcaccagctttgatccggccaccgcgggcgtcgacgaggatgatattgag
gtatcgggaggccgggccacgttacatgtggtcacgggcccacctgctgctgggaagtcc
accttcgtccgtgagcatgcccggctaggggatgtggtcctagactacgacctgctggcc
aacgcgctggcgggggaacctgctgacaaccatgagcacaccaggcagatcaaggcggtg
accaaggcggccaggctcgcagccctggaggcagcgatgaagcaggacatcaccgtctgg
ctgattcactcaaccccggccgcctcgaccttgtctcgctacgagtcgatgggcgccacg
gtccatgtggtcgacccgggtaaggacgtggtgatgaagcgggtcaagcagatgcggcca
cgggtgatgctgccggtggcggctgcctggtacgacaagcagccggcggtggccacgccg
aagaccacgaccgagcgtggccttgggtgggatcatcagaagcaacgcgcgaacctcgtc
gcggtccatgttgatggcacaccgtgttggtggtgtggccggccgatgttctacgacaag
acccgcaacttcgatggtctgccgctggctgctgaccatgaggatgcccgagcaaacggc
ggggaccgcgctaaccgcctcttacacttctcctgcaactcctcacggcaagcaggggcc
cgcgacgaccaacgaccagccctgaaccactctgaaccgcctacggagcccacagcgcca
ccacaggccacgccggcggcgtcggtgttcgcctggccagaccttgagccgtctcgcgcc
gggccctag


  DNA with Flanking Sequence

>fig|196164.6.peg.853 FIG00548751: hypothetical protein
gcaacctccgggtgatcgtgctattcatgtccgggcggcgtggttgcagcagcagctatt
cgtcattgatgagatgccgtggggtgagatgtgcgcggaggaggtcattgcgtcttcgag
gttagttcgggatgtcgtggtggacccgcgggaatgggatgacccgaagccaattgagat
tggttcgtgtagagagatcgtgagttgggctcggcacctgggggcgcaggtgtctaggtc
aacagtgcagcggtggattgaccgaggagagataccttccgagattgcgccggatggtcg
tgtccttatatcgctggccaatgtgctggaccacgcgcgagcaggacttcttgagagtgg
gccaccccgtgctgtaagctgacgctcgatagatccaaccccgaagttgcctggcaactc
tcggggttttgtcgtgtctggaggtggtcatcatcctcacggtcgtgacaggtgctccag
cggcggggaagtccacgtgggtggccaccgtcgcgaagccgggtgatctacggtttgatt
ctgatgcgctgaccaacaccctgacgggtaagcctccggcgaagcattcgcatgcggctg
cggtgaagaaggtgtcgaagtccgctcgtgaggcgggtattgaagaagcattgaagttgg
tggccacgcgcgatgtgtggatcattcactcgaatctctcggctgaactcgagcggaagt
accgggcatatggtgctcggtttgtggtgattgaccccggtgaggctgtggccttggaac
ggtgtgctgctggtcgccctgggtatcggaagaatcaggtggcctcctggtacgcgcgtc
ggcattcgtggccacatgatgcggagatcatcaccagctttgatccggccaccgcgggcg
tcgacgaggatgatattgaggtatcgggaggccgggccacgttacatgtggtcacgggcc
cacctgctgctgggaagtccaccttcgtccgtgagcatgcccggctaggggatgtggtcc
tagactacgacctgctggccaacgcgctggcgggggaacctgctgacaaccatgagcaca
ccaggcagatcaaggcggtgaccaaggcggccaggctcgcagccctggaggcagcgatga
agcaggacatcaccgtctggctgattcactcaaccccggccgcctcgaccttgtctcgct
acgagtcgatgggcgccacggtccatgtggtcgacccgggtaaggacgtggtgatgaagc
gggtcaagcagatgcggccacgggtgatgctgccggtggcggctgcctggtacgacaagc
agccggcggtggccacgccgaagaccacgaccgagcgtggccttgggtgggatcatcaga
agcaacgcgcgaacctcgtcgcggtccatgttgatggcacaccgtgttggtggtgtggcc
ggccgatgttctacgacaagacccgcaacttcgatggtctgccgctggctgctgaccatg
aggatgcccgagcaaacggcggggaccgcgctaaccgcctcttacacttctcctgcaact
cctcacggcaagcaggggcccgcgacgaccaacgaccagccctgaaccactctgaaccgc
ctacggagcccacagcgccaccacaggccacgccggcggcgtcggtgttcgcctggccag
accttgagccgtctcgcgccgggccctaggtcaaatatctggcggtatacgtgctgaccc
ttcctcggccgccagtcagcccatttttgtgagtcctgaaactgagagcgtgcccactgc
cagataggagccatgatgactgaacaacccccaattgcccatgaatcccttggcgctggt
gccgatgtcgggatggggcaggggctccgagctcctgggcgcgcggtctatgaagccctt
gtccaaccgggcatggacttagcggacatcgccctgtgtgaggaagccggccgtcagcgt
gatcggctcgatcaactgcagaagatcatctcaggtgatgaagcaacctgggcaaccatc
gtcgaaagctccggcgggacactcacgctgcgtatcgacagcgcagtcgcggaagcccgc
cagagcctcaccgtgtttcgccagctcattggatcgatcaaagcgaggtggacggatgcc
tacatcacagcggatgcagatgttctcgatgggtttggagaagtggcct


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
cmr|NT01CE0871 Corynebacterium efficiens YS-314     hypothetical protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search