The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|196164.6.peg.848: Corynebacterium efficiens YS-314

This feature in The SEED Viewer

NCBI Taxonomy Id: 196164

Current Assignment: FIG00549153: hypothetical protein
Translate Function Assignments



Context on contig NC_004369 from base 876839 to 888274 (11436 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
842 876988 876839 150 -           hypothetical protein locus|CE0821, protein_id|NP_737431.1, gi|25027377, geneID|1032927
843 879243 879482 240 + 2254         hypothetical protein locus|CE0825, protein_id|NP_737435.1, gi|25027381, geneID|1032931
844 879697 879575 123 - 92         hypothetical protein  
845 880015 880233 219 + 317         hypothetical protein locus|CE0827, protein_id|NP_737437.1, gi|25027383, geneID|1032933
846 880497 881018 522 + 263         hypothetical protein locus|CE0828, protein_id|NP_737438.1, gi|25027384, geneID|1032934
847 881146 881979 834 + 127         FIG00549605: hypothetical protein locus|CE0829, protein_id|NP_737439.1, gi|25027385, geneID|1032935
848 881988 882272 285 + 8         FIG00549153: hypothetical protein locus|CE0830, protein_id|NP_737440.1, gi|25027386, geneID|1032936
849 882313 882477 165 + 40         hypothetical protein  
850 882477 882776 300 + -1         hypothetical protein locus|CE0831, protein_id|NP_737441.1, gi|25027387, geneID|1032937
851 883684 884085 402 + 907         hypothetical protein locus|CE0834, protein_id|NP_737444.1, gi|25027390, geneID|1032940
852 885062 886327 1266 + 976         hypothetical protein locus|CE0837, protein_id|NP_737447.1, gi|25027393, geneID|1032943
853 887066 888274 1209 + 738         FIG00548751: hypothetical protein locus|CE0839, protein_id|NP_737449.1, gi|25027395, geneID|1032945

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|196164.6.peg.848 FIG00549153: hypothetical protein
MVLYVLLLVLTACFCVIIFWLTEWVIRLRKANEEMDADLCDAEEQLHEHVGILRDLEIMR
RKLESVPARITALEARNRVVAAEGGEDDVVYVSG

MD5 = 265a42056ed42f5345f47d6a689ee865


  DNA Sequence

>fig|196164.6.peg.848 FIG00549153: hypothetical protein
atggtcttgtatgtgctgttgctggtgctcacggcctgtttctgcgtgatcattttctgg
ctgacggagtgggtgattcggctccggaaagcgaatgaggagatggatgccgacctctgt
gatgcggaggagcagctccatgagcatgtggggattcttcgcgatctggagatcatgcgt
cgcaagctcgaatcggtgcccgccaggatcacggccttggaggcccgtaaccgggtcgtg
gctgcggagggaggtgaagacgatgtcgtctatgtcagcgggtga


  DNA with Flanking Sequence

>fig|196164.6.peg.848 FIG00549153: hypothetical protein
cgtcttcggcaggaaggtgcttcgaccaaccttgatctgatcaagatgcagaccaacgag
atcgacaatctccgtaaggatctggctgatgccaagaaggactctaagactcaggccact
tcatcgtcctcgcgagtcgaggagctcgaagcagccctcaagctcagcagggacctccag
gccgaggccaccaccgacctcgagcagacccgcgccgcactcgtcaccgcgcgccgggag
gctgacgagtccgcgcagaaggtggaggagctgacgcgtcagctgtcctcttatcaaagc
gacttcgtggagcgggataatcagctctccgctatggaaggccgtctcttccgtgaggtg
gagcagttgcaggataagcaacgcaagatccatgtgcacttaacgcgagctctcaggaaa
tttgaggacgatccgaacatgacgatccgggctatcgactcagccttaaagctcgctggg
aaggcatcatgagtgacgttatggtcttgtatgtgctgttgctggtgctcacggcctgtt
tctgcgtgatcattttctggctgacggagtgggtgattcggctccggaaagcgaatgagg
agatggatgccgacctctgtgatgcggaggagcagctccatgagcatgtggggattcttc
gcgatctggagatcatgcgtcgcaagctcgaatcggtgcccgccaggatcacggccttgg
aggcccgtaaccgggtcgtggctgcggagggaggtgaagacgatgtcgtctatgtcagcg
ggtgagtatccaagctctgttgttgatgacgcgatctttgagtgtgtggagaagatcagc
ggggtgtgggaggctgccggcctgaatgcggaatcagaggccgagatcctcacacaagag
cttcacaccgcggtgtcagatgcattcgagcgtctgttattccgccggggtgtggcgatt
gatcggctcaagcggggatcgggacgctgatggcctcggtgcgtcaactcctggacccca
gcgggaaacgcctcatccgcctcgctgtggcaccccttgacagtggccggttgattgccc
tgggggacctcaatgacctgatcaagatcccggtgtggaccaccgtcatgcggatccacg
tggccaacaccccgttgatccaccggcagaggttcattcacgttgtcactctccgggagt
gggtgcggcagttagccggccgggatcacaagaaatcagctggtgagctcgaacggttca
tcgactggattgtcaccgtcgacct


  Assignments for Essentially Identical Proteins

No essentially identical proteins found

  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


Tool Description
General Tools
Psi-Blast NCBI's psi-blast is used to locate distant similarities
Transmembrane Predictions
TMpred Tool for Predicting Transmembrane regions
TMHMM Prediction of transmembrane helices in proteins
Protein Signals for Gram negative bacteria
Gram negative PSORT Prediction of protein localization sites
Gram negative SignalP Predicts the presence and location of signal peptide cleavage sites
Protein Signals for Gram positive bacteria
Gram positive PSORT Prediction of protein localization sites
Gram positive SignalP Predicts the presence and location of signal peptide cleavage sites
Other useful tools
LipoP Prediction of lipoproteins and signal peptides in Gram negative bacteria
Radar Rapid Automatic Detection and Alignment of Repeats in protein sequences
PPSearch Search for protein motifs against all patterns stored in the PROSITE pattern database
Gram negative CELLO Subcellular localization predictor at National Chiao Tung University
Gram positive CELLO Subcellular localization predictor at National Chiao Tung University
ProDom A comprehensive set of protein domain families automatically generated from the SWISS-PROT and TrEMBL sequence databases
PDB An Information Portal to Biological Macromolecular Structures
For Specific Organisms
RNAFold The RNAfold web server will predict secondary structures of single stranded RNA or DNA sequences.

< Hide tool descriptions


FIG search