The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|196164.6.peg.843: Corynebacterium efficiens YS-314

This feature in The SEED Viewer

NCBI Taxonomy Id: 196164

Current Assignment: hypothetical protein
Translate Function Assignments



Context on contig NC_004369 from base 873272 to 884085 (10814 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
838 873272 874537 1266 +           Integrase locus|CE0816, protein_id|NP_737426.1, gi|25027372, geneID|1032922
839 875622 874987 636 - 449         FIG00548736: hypothetical protein locus|CE0818, protein_id|NP_737428.1, gi|25027374, geneID|1032924
840 875953 875774 180 - 151         FIG00546693: hypothetical protein locus|CE0819, protein_id|NP_737429.1, gi|25027375, geneID|1032925
841 876093 876287 195 + 139         hypothetical protein  
842 876988 876839 150 - 551         hypothetical protein locus|CE0821, protein_id|NP_737431.1, gi|25027377, geneID|1032927
843 879243 879482 240 + 2254         hypothetical protein locus|CE0825, protein_id|NP_737435.1, gi|25027381, geneID|1032931
844 879697 879575 123 - 92         hypothetical protein  
845 880015 880233 219 + 317         hypothetical protein locus|CE0827, protein_id|NP_737437.1, gi|25027383, geneID|1032933
846 880497 881018 522 + 263         hypothetical protein locus|CE0828, protein_id|NP_737438.1, gi|25027384, geneID|1032934
847 881146 881979 834 + 127         FIG00549605: hypothetical protein locus|CE0829, protein_id|NP_737439.1, gi|25027385, geneID|1032935
848 881988 882272 285 + 8         FIG00549153: hypothetical protein locus|CE0830, protein_id|NP_737440.1, gi|25027386, geneID|1032936
849 882313 882477 165 + 40         hypothetical protein  
850 882477 882776 300 + -1         hypothetical protein locus|CE0831, protein_id|NP_737441.1, gi|25027387, geneID|1032937
851 883684 884085 402 + 907         hypothetical protein locus|CE0834, protein_id|NP_737444.1, gi|25027390, geneID|1032940

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|196164.6.peg.843 hypothetical protein
MHVTTKAVRALDADKLQALIDEGFTFVTTRFNQAISEIVVVRGSTVDVQFPETAYATPVR
IDTITAVHKPELDDDEEAA

MD5 = 6ef688b97d717073469d372bab2ab091


  DNA Sequence

>fig|196164.6.peg.843 hypothetical protein
atgcatgttaccacgaaggctgtccgcgctcttgatgcggacaagctgcaagcactcatc
gatgaggggttcaccttcgtcacgactcggttcaaccaggcgatctcggagatcgtcgtt
gtgcggggttccacggttgatgtccagttcccggagaccgcttatgcaactccggtgcgt
atcgacacgattaccgcggttcataagccagagctcgatgatgacgaggaggcagcgtaa


  DNA with Flanking Sequence

>fig|196164.6.peg.843 hypothetical protein
cctccaggcggcggaaattgttaagcgtcgagaagcccacatcagagcagccgagctgtt
aaacaggcctgccgcgtgatcgcgccgggagaggaaatgatgaacattcgattgaagaag
tttccagagaagaccactgactttctcggccgtggccgtgtgatcaccgtcggggatgtc
gaaattaagtgggatgccggcatctgcgcatgggagtgcagcttgccaggtgtcggcctg
atgaggtcgtacctgatcggacgtgtcgtcgatggcgaggtgcttgtcaccgagaacctc
ctccacgaccgcccggcccaaggcccgttggctacccgggcgacggccgtcctcgaggga
ctgctcgcagccggtgaggatctcggccagtgggagaggtgcgagtgatgccgaatctgg
aaagcaggttaggggaagaaaaaacccgtccaggacggcaaatctcgggacggggaatcc
aagaaaagaaaggatctgacatgcatgttaccacgaaggctgtccgcgctcttgatgcgg
acaagctgcaagcactcatcgatgaggggttcaccttcgtcacgactcggttcaaccagg
cgatctcggagatcgtcgttgtgcggggttccacggttgatgtccagttcccggagaccg
cttatgcaactccggtgcgtatcgacacgattaccgcggttcataagccagagctcgatg
atgacgaggaggcagcgtaatgggatgggtccggaaagacgcgctcttaaaatgggcggt
cgtcgaggagacaaccgcaagggtgatcgttggtcataggcggtataaggcttcagtcaa
gttccttttcctcggggaagtagatgtcattgctatagacctctacaaaccggtaaccct
tccggtttccgctgtggaagaaattaacgaactcgtcgtactcatcgtccgtcatgtgct
tcgagatctcggggtgtcgaggggtggggactatgaacctcacgtcagagtcaagctcaa
cccagattcgaggcgctccctcaacgacaagaataaacggtactccgtcctcctggagct
ggttccagcatccgtagatgaaggtgtaagcccagttgtacatctcgcgctggtgtccgt
tgacttcaagaatccacgattcatgcatgtccagaggatacgacgcaggcttctcaagcg
caggctaatacgaaaagaccgagcaaataagaggaatgca


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
gb|EEW50452.1 Corynebacterium efficiens YS-314     conserved hypothetical protein
gi|259165898 Corynebacterium efficiens YS-314 NCBI   conserved hypothetical protein
gi|259506478 Corynebacterium efficiens YS-314 NCBI   conserved hypothetical protein
ref|ZP_05749380.1 Corynebacterium efficiens YS-314 RefSeq   conserved hypothetical protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search