The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|196164.6.peg.839: Corynebacterium efficiens YS-314

This feature in The SEED Viewer

NCBI Taxonomy Id: 196164

Current Assignment: FIG00548736: hypothetical protein
Translate Function Assignments



Context on contig NC_004369 from base 868896 to 881018 (12123 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
833 868896 870059 1164 +       4: 4 7 1 8   Peptide chain release factor 2 gene_name|prfB, locus|CE0811, protein_id|NP_737421.1, gi|25027367, geneID|1032917
834 870148 870837 690 + 88     2: 3 2   Cell-division-associated, ABC-transporter-like signaling protein FtsE locus|CE0812, protein_id|NP_737422.1, gi|25027368, geneID|1032918
835 870853 871755 903 + 15     2: 3 2   Cell-division-associated, ABC-transporter-like signaling protein FtsX locus|CE0813, protein_id|NP_737423.1, gi|25027369, geneID|1032919
836 871792 872286 495 + 36     3: 1 6 5   tmRNA-binding protein SmpB gene_name|smpB, locus|CE0814, protein_id|NP_737424.1, gi|25027370, geneID|1032920
837 872286 872645 360 + -1         DUF488 family protein SAV0238 locus|CE0815, protein_id|NP_737425.1, gi|25027371, geneID|1032921
838 873272 874537 1266 + 626         Integrase locus|CE0816, protein_id|NP_737426.1, gi|25027372, geneID|1032922
839 875622 874987 636 - 449         FIG00548736: hypothetical protein locus|CE0818, protein_id|NP_737428.1, gi|25027374, geneID|1032924
840 875953 875774 180 - 151         FIG00546693: hypothetical protein locus|CE0819, protein_id|NP_737429.1, gi|25027375, geneID|1032925
841 876093 876287 195 + 139         hypothetical protein  
842 876988 876839 150 - 551         hypothetical protein locus|CE0821, protein_id|NP_737431.1, gi|25027377, geneID|1032927
843 879243 879482 240 + 2254         hypothetical protein locus|CE0825, protein_id|NP_737435.1, gi|25027381, geneID|1032931
844 879697 879575 123 - 92         hypothetical protein  
845 880015 880233 219 + 317         hypothetical protein locus|CE0827, protein_id|NP_737437.1, gi|25027383, geneID|1032933
846 880497 881018 522 + 263         hypothetical protein locus|CE0828, protein_id|NP_737438.1, gi|25027384, geneID|1032934

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|196164.6.peg.839 FIG00548736: hypothetical protein
MAFPIELTVALSGATKHQLYSWNKKGLLSPEISTDRIEGFLWSFRDIVALRTFIKLRSDH
SLQAIRKALTNLRELSLTEHPSTYTLTSDGTSVFLVEDDGKNATDLLRERGQKIITNLDD
VLKGFRHPSNKGDVVDLLHPRKRLEVNEGKLGGFPTIRGTRVAYDTIANLIYDGEVRPKD
VELYFPDVTAADAKDALDFYHQVERGEGWVA

MD5 = 5b6ac35503db4a231cf19762221e014c


  DNA Sequence

>fig|196164.6.peg.839 FIG00548736: hypothetical protein
atggcttttccaattgaactcaccgtcgcgctctccggtgccacaaaacatcagctctac
agttggaacaaaaagggattgcttagccccgaaatcagtaccgaccggattgaaggcttc
ctctggtcgttcagagacatcgtcgcgctccgaaccttcatcaagctgaggtctgatcac
tccctgcaggccatcaggaaagcgctgaccaacctccgtgaactcagtctcaccgaacac
ccttcgacctacacgctgaccagcgacggcacctcggtgttcctcgtcgaagatgatggg
aaaaacgcgaccgacctgctgcgcgaacgcggccagaaaatcatcaccaacctcgacgat
gttctcaagggtttccgccatccctccaacaagggagacgtcgtagaccttctccatccc
cgcaagcggctcgaagtcaatgaagggaaactcggcggtttccctaccatccgaggaacg
cgcgtagcctacgacaccatcgcgaatctcatttacgacggtgaagtcaggcccaaagac
gtcgaactctacttccccgacgtcactgctgctgatgccaaagacgccctggatttctac
caccaggttgaacgcggcgaggggtgggtcgcttga


  DNA with Flanking Sequence

>fig|196164.6.peg.839 FIG00548736: hypothetical protein
ctgcaccagctcctgcaccagctcctgcaccggttgggcgcacagtaaccgctggcgcat
tctgcaaaaatatagagcagggagcaatcggttacaccaccacggggctccaaatgacct
gcacctacgatgcaggcgaaaaccgcgcacgttggaggtagagacatccgtgatgatctt
gaggacccctgatcacgctttcatcggcgacgaggttgacatcgccacccagatcctggg
agagctacagatgcctctgacacccgagcgtctcaagcacctggccgtggccatcctcgg
ctgcgaactcagtgagatcaggttagagaccatgtcgcccaaccaatagtcggcccccgc
aactacccgaaagtgcccgcaaccgcccatcattgcggtaaagtactagcaacgtaatta
catcaacacgcccagggtctggacgtgtggacggccgaccctgaataatggtggtaggcc
accattaggaggtgaaccacatggcttttccaattgaactcaccgtcgcgctctccggtg
ccacaaaacatcagctctacagttggaacaaaaagggattgcttagccccgaaatcagta
ccgaccggattgaaggcttcctctggtcgttcagagacatcgtcgcgctccgaaccttca
tcaagctgaggtctgatcactccctgcaggccatcaggaaagcgctgaccaacctccgtg
aactcagtctcaccgaacacccttcgacctacacgctgaccagcgacggcacctcggtgt
tcctcgtcgaagatgatgggaaaaacgcgaccgacctgctgcgcgaacgcggccagaaaa
tcatcaccaacctcgacgatgttctcaagggtttccgccatccctccaacaagggagacg
tcgtagaccttctccatccccgcaagcggctcgaagtcaatgaagggaaactcggcggtt
tccctaccatccgaggaacgcgcgtagcctacgacaccatcgcgaatctcatttacgacg
gtgaagtcaggcccaaagacgtcgaactctacttccccgacgtcactgctgctgatgcca
aagacgccctggatttctaccaccaggttgaacgcggcgaggggtgggtcgcttgaagtt
cgccatcgacgctaacgaatcccccgcccttagcaactcctgggatctgctcttccccac
ccatgaatttgttcatgtccgttcactaggattacgcaacgatagtgacattgagctctt
tgctaaacttcccggcgaaggtttcgatgcctttatcacccgagaccgagcgcaactaaa
acgagacgacgaactgcaagccctcaaggaatcgggcctatcgtggatcgggcataaaga
acccgccgcgcgtggtccccgatcacttgccgtcgtggttgcctcctatagcatcgccat
cccccacatcgtcgatctaatcgagaacgcctcagaccccctacgctttcacgtcaagct
gactcctcatggggccggacaaacaatctctgctcatcgcctctccgataaccaaaaggt
cgctctccccaaataaatcctgaacttatccggcagcctccccgctgctggtttttctct
tctcggcacgcttctt


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
cmr|NT01CE0850 Corynebacterium efficiens YS-314     hypothetical protein
gb|EEW50461.1 Corynebacterium efficiens YS-314     toxin-antitoxin system, antitoxin component
gi|259165907 Corynebacterium efficiens YS-314 NCBI   toxin-antitoxin system, antitoxin component
gi|259506487 Corynebacterium efficiens YS-314 NCBI   toxin-antitoxin system, antitoxin component
ref|ZP_05749389.1 Corynebacterium efficiens YS-314 RefSeq   toxin-antitoxin system, antitoxin component


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search