The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|195102.6.peg.1187: Clostridium perfringens str. 13

This feature in The SEED Viewer

NCBI Taxonomy Id: 195102

Current Assignment: FIG00513960: hypothetical protein
Translate Function Assignments



Context on contig NC_003366 from base 1307241 to 1318415 (11175 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1177 1307241 1307561 321 +           no significant homology. locus|CPE1105, protein_id|NP_562021.1, gi|18310087, geneID|989414
1178 1307575 1307745 171 + 13         no significant homology. locus|CPE1106, protein_id|NP_562022.1, gi|18310088, geneID|989415
1179 1307775 1308695 921 + 29         no significant homology. locus|CPE1107, protein_id|NP_562023.1, gi|18310089, geneID|989416
1180 1309065 1309247 183 + 369         no significant homology locus|CPE1108, protein_id|NP_562024.1, gi|18310090, geneID|989417
1181 1309449 1309904 456 + 201         FIG00526667: hypothetical protein locus|CPE1109, protein_id|NP_562025.1, gi|18310091, geneID|989418
1182 1310119 1311216 1098 + 214         kilA protein, putative phage-related DNA binding protein locus|CPE1110, protein_id|NP_562026.1, gi|18310092, geneID|989419
1183 1311383 1311649 267 + 166         FIG00522631: hypothetical protein locus|CPE1112, protein_id|NP_562028.1, gi|18310094, geneID|989421
1184 1311688 1312071 384 + 38         no significant homology. locus|CPE1113, protein_id|NP_562029.1, gi|18310095, geneID|989422
1185 1312073 1312252 180 + 1         FIG00523724: hypothetical protein locus|CPE1114, protein_id|NP_562030.1, gi|18310096, geneID|989423
1186 1312258 1312500 243 + 5         FIG00533121: hypothetical protein locus|CPE1115, protein_id|NP_562031.1, gi|18310097, geneID|989424
1187 1312560 1312970 411 + 59       FIG00513960: hypothetical protein locus|CPE1116, protein_id|NP_562032.1, gi|18310098, geneID|989425
1188 1313082 1313567 486 + 111         hypothetical protein locus|CPE1117, protein_id|NP_562033.1, gi|18310099, geneID|989426
1189 1313567 1315243 1677 + -1 15     Phage terminase large subunit locus|CPE1118, protein_id|NP_562034.1, gi|18310100, geneID|989427
1190 1315442 1316665 1224 + 198 7     Phage portal protein locus|CPE1120, protein_id|NP_562036.1, gi|18310102, geneID|989429
1191 1316640 1317242 603 + -26 5     phage phi-C31 gp35-like protein locus|CPE1121, protein_id|NP_562037.1, gi|18310103, geneID|989430
1192 1317279 1318415 1137 + 36 8     hypothetical protein locus|CPE1122, protein_id|NP_562038.1, gi|18310104, geneID|989431

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|195102.6.peg.1187 FIG00513960: hypothetical protein
MIYTICGKCGDKIKVGTKCERCTKEAYRQYKHYRKDKREQQFYANNQWKTLSEIIKRRYL
GMCLNCWDKGIIEMCTTTHHIIELKEDWNRRLDKDNLIPLCTRCHQKIHNEYKNNKAIEQ
ARLRDILKKYKETYKL

MD5 = 9d769a3eecf8e61759fdd80e5e9c44ff


  DNA Sequence

>fig|195102.6.peg.1187 FIG00513960: hypothetical protein
atgatatatacaatatgtggtaaatgtggagataaaataaaggtaggaactaagtgtgaa
cggtgtactaaggaagcatatagacagtataagcattatagaaaagataagagagagcaa
cagttctatgctaacaatcaatggaaaacattatcagaaattattaagagaagatattta
ggcatgtgcttgaattgttgggacaaaggtattatagaaatgtgtactactacacatcac
ataatagagttaaaagaagattggaatagaaggttagataaagataacttaataccatta
tgtactagatgtcatcagaagatacataatgaatataagaataataaggctatagaacaa
gctaggttaagagatatattaaaaaaatataaggagacatataaattataa


  DNA with Flanking Sequence

>fig|195102.6.peg.1187 FIG00513960: hypothetical protein
ggagagaattaatatggggattttagaagttttaacattaatatttatagtattaaagct
atgtggagtaattgcttggacttggtggttagttttattaccagagattataggattaat
attatactttatagttgggataggaattacaattacaggaaagaaaattagtagtaagaa
aatggaggattaaaaaagatgataggatttactagaaaagaaagaaaaattataaaaaca
tattttaatagaagaaataatttaagacatttagctgataatatagaaaagttagaagat
aaagagttagctaatattttaagaaagactttatttaatagatataaggtagagtttata
agtggaaatgaagatagattagcagatatctatactaaagaaatgttagaaattggtgtt
aagtcttattgtatattatagatattattatcttaaataaaatacacgtaaatgagtatt
aataataaaggagaataaagatgatatatacaatatgtggtaaatgtggagataaaataa
aggtaggaactaagtgtgaacggtgtactaaggaagcatatagacagtataagcattata
gaaaagataagagagagcaacagttctatgctaacaatcaatggaaaacattatcagaaa
ttattaagagaagatatttaggcatgtgcttgaattgttgggacaaaggtattatagaaa
tgtgtactactacacatcacataatagagttaaaagaagattggaatagaaggttagata
aagataacttaataccattatgtactagatgtcatcagaagatacataatgaatataaga
ataataaggctatagaacaagctaggttaagagatatattaaaaaaatataaggagacat
ataaattataagataccgggggagtggtcattgatacgatagaaatgtcaaaaagtccga
gtcactctctcagtaacacaaaattcccttatgaatattttttaggaaggaggaggataa
tattggctaaagcatctaaaccagtaaatttactaaataaacatttaactaaagaagaaa
ttgcaaatagaaaagaacaggaagaaaagttaaaaggtagagataataaagtttatagaa
ctcctaccaccctttctaaagaagggaaaaaagtttataaaaatttagtaggagaactaa
gagaaagcaatatattaaacaatttagatatagaaatattattaacaactgtagattcta
tattaagaatgcaagaatgtaaagatataatagataaaactggagttattctaactaagg
aagatggtacattatatagaaatccagcgactactatttataaagattataatgctatat
ataataaatgctgcatggagctaggattaag


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0003676       F:nucleic acid binding
GO:0004519       F:endonuclease activity
cmr|NT03CP1183 Clostridium perfringens 13     bacteriophage L54a, HNH endonuclease family protein
dbj|BAB80822.1 Clostridium perfringens str. 13     phage-related conserved hypothetical protein
fig|195102.1.peg.1179 Clostridium perfringens str. 13 FIG   FIG00513960: hypothetical protein
gi|18144777 Clostridium perfringens str. 13 NCBI   phage-related conserved hypothetical protein
gi|18310098 Clostridium perfringens str. 13 NCBI   hypothetical protein CPE1116
img|637252471 Clostridium perfringens 13 IMG   hypothetical protein
kegg|cpe:CPE1116 Clostridium perfringens 13 KEGG   hypothetical protein
pathema|ntcp03.3.cds.ORF01301 Clostridium perfringens     bacteriophage L54a, HNH endonuclease family protein
ref|NP_562032.1 Clostridium perfringens str. 13 RefSeq   hypothetical protein CPE1116
tr|Q8XLC6 Clostridium perfringens TrEMBL   Putative uncharacterized protein CPE1116


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function
15 fig|195102.6.peg.1189 Phage terminase large subunit
7 fig|195102.6.peg.1190 Phage portal protein
5 fig|195102.6.peg.1191 phage phi-C31 gp35-like protein
8 fig|195102.6.peg.1192 hypothetical protein


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search