The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|195102.6.peg.1182: Clostridium perfringens str. 13

This feature in The SEED Viewer

NCBI Taxonomy Id: 195102

Current Assignment: kilA protein, putative phage-related DNA binding protein
Turn Off Function Translation



Context on contig NC_003366 from base 1303510 to 1316665 (13156 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1175 1303510 1306695 3186 +           FIG00526792: hypothetical protein locus|CPE1103, protein_id|NP_562019.1, gi|18310085, geneID|989412
1176 1306777 1307226 450 + 81         no significant homology. locus|CPE1104, protein_id|NP_562020.1, gi|18310086, geneID|989413
1177 1307241 1307561 321 + 14         no significant homology. locus|CPE1105, protein_id|NP_562021.1, gi|18310087, geneID|989414
1178 1307575 1307745 171 + 13         no significant homology. locus|CPE1106, protein_id|NP_562022.1, gi|18310088, geneID|989415
1179 1307775 1308695 921 + 29         no significant homology. locus|CPE1107, protein_id|NP_562023.1, gi|18310089, geneID|989416
1180 1309065 1309247 183 + 369         no significant homology locus|CPE1108, protein_id|NP_562024.1, gi|18310090, geneID|989417
1181 1309449 1309904 456 + 201         FIG00526667: hypothetical protein locus|CPE1109, protein_id|NP_562025.1, gi|18310091, geneID|989418
1182 1310119 1311216 1098 + 214         kilA protein, putative phage-related DNA binding protein locus|CPE1110, protein_id|NP_562026.1, gi|18310092, geneID|989419
1183 1311383 1311649 267 + 166         FIG00522631: hypothetical protein locus|CPE1112, protein_id|NP_562028.1, gi|18310094, geneID|989421
1184 1311688 1312071 384 + 38         no significant homology. locus|CPE1113, protein_id|NP_562029.1, gi|18310095, geneID|989422
1185 1312073 1312252 180 + 1         FIG00523724: hypothetical protein locus|CPE1114, protein_id|NP_562030.1, gi|18310096, geneID|989423
1186 1312258 1312500 243 + 5         FIG00533121: hypothetical protein locus|CPE1115, protein_id|NP_562031.1, gi|18310097, geneID|989424
1187 1312560 1312970 411 + 59         FIG00513960: hypothetical protein locus|CPE1116, protein_id|NP_562032.1, gi|18310098, geneID|989425
1188 1313082 1313567 486 + 111         hypothetical protein locus|CPE1117, protein_id|NP_562033.1, gi|18310099, geneID|989426
1189 1313567 1315243 1677 + -1         Phage terminase large subunit locus|CPE1118, protein_id|NP_562034.1, gi|18310100, geneID|989427
1190 1315442 1316665 1224 + 198         Phage portal protein locus|CPE1120, protein_id|NP_562036.1, gi|18310102, geneID|989429

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|195102.6.peg.1182 kilA protein, putative phage-related DNA binding protein
MKELQLLTEKEVLKGQNITIYGTGENPLFLARDVANIIGHSKARDMIADVDEDEKIKMPF
KMASSRSTQSQWFLTEDGLYEVLLTSRKPVAKQFRKEVKKILKQLRQKGVVILENATKEA
INFEEKFGTYRIRKTFLNSTNITEDYKLFTELSKQEWKAKRLNNDDRVKLSKLIVKGLEQ
RLNRDKSKLRASEMLAMQELLTDINKDIIKLENKKHGGLKTGQQKQITKLKQQLEDIETK
YVVRDEEFVTLDCHGFSNNYMYSYIEGKCVKSNAYKNWIKYFPYNQVPDVDYWDVDFTKP
VEMFINYIAKKDVDIQNLDKSFIDRIFDIYNFNDNIVQAVHRQSIGTVDNFADGKISFYI
RNIEE

MD5 = c193bc8363197f1aa9ff4ffa69ab79ce


  DNA Sequence

>fig|195102.6.peg.1182 kilA protein, putative phage-related DNA binding protein
atgaaggaattacaattattaacagaaaaagaagtattaaaaggacaaaacataacaatt
tatgggacaggagaaaatccattatttctagctagagatgtagcaaatataataggacat
tctaaagcaagagatatgatagcagatgtagatgaagatgaaaaaataaagatgcctttt
aaaatggcgtcttcaagatcaacacagtctcaatggtttttaacagaagatggactttat
gaagtattacttacaagtagaaaacctgttgcaaaacaattcagaaaagaagttaagaaa
attcttaaacaactaagacaaaaaggcgttgtaatactagagaatgctactaaagaagct
attaatttcgaagagaagtttggtacatacagaattagaaaaacattcttaaactctaca
aatattacagaagattataaattatttacagagttatctaaacaagaatggaaagctaaa
agattaaataatgatgatagagttaaactatctaagctaattgtcaaaggtttagaacaa
agactaaatagagataagtctaaattaagagcaagtgaaatgttagctatgcaggaatta
ttaactgatataaataaagatattattaaactggaaaataaaaaacatggaggtttgaaa
acggggcaacagaagcagataactaaattaaagcaacaattagaagatatagaaactaaa
tatgttgttagagatgaagaatttgtgacgttagattgtcatggctttagtaataattat
atgtatagctatatagaaggtaaatgcgttaagtctaatgcatataaaaattggattaaa
tattttccttataatcaagtgccagatgtcgattattgggatgtagactttactaaacct
gtcgagatgtttataaactacatagcaaagaaagatgtagatattcaaaatttagataag
tcatttattgaccgtatttttgatatatataattttaatgacaatatagtacaagcagta
catagacaaagcatcggaactgtagataattttgcagacggaaaaatatctttttacata
agaaatatagaagaatag


  DNA with Flanking Sequence

>fig|195102.6.peg.1182 kilA protein, putative phage-related DNA binding protein
aagtcaacttatgtatttatttattaagaatctttattatacagaagttaattggagaac
taaagaaatacatagaactaatagtttcttgtatagaaaggctaaacaattagctacttg
gagtgctagaaataataaagataaagtagagaagattaacaaagaaatagtagaaagata
taaagaaacagaaaatttaaaacaagaagttgcttattataagcaatttgttagtgtttt
ctatgatataaaaacagatatagaagaatgggagtggcttagatagacactcttttttta
tacccttttttcttaagaattaaggctagtagataatagttactctttataattaaatat
caaatttagtaatcctttagctagtatgcgtacgaccaagcaagctaagaaagttagatc
ataggtgggtttattacacagttaagatgttctgtgttatcaaaaacatcaaaaatttat
tataaaggggatattaaaaaatgaaggaattacaattattaacagaaaaagaagtattaa
aaggacaaaacataacaatttatgggacaggagaaaatccattatttctagctagagatg
tagcaaatataataggacattctaaagcaagagatatgatagcagatgtagatgaagatg
aaaaaataaagatgccttttaaaatggcgtcttcaagatcaacacagtctcaatggtttt
taacagaagatggactttatgaagtattacttacaagtagaaaacctgttgcaaaacaat
tcagaaaagaagttaagaaaattcttaaacaactaagacaaaaaggcgttgtaatactag
agaatgctactaaagaagctattaatttcgaagagaagtttggtacatacagaattagaa
aaacattcttaaactctacaaatattacagaagattataaattatttacagagttatcta
aacaagaatggaaagctaaaagattaaataatgatgatagagttaaactatctaagctaa
ttgtcaaaggtttagaacaaagactaaatagagataagtctaaattaagagcaagtgaaa
tgttagctatgcaggaattattaactgatataaataaagatattattaaactggaaaata
aaaaacatggaggtttgaaaacggggcaacagaagcagataactaaattaaagcaacaat
tagaagatatagaaactaaatatgttgttagagatgaagaatttgtgacgttagattgtc
atggctttagtaataattatatgtatagctatatagaaggtaaatgcgttaagtctaatg
catataaaaattggattaaatattttccttataatcaagtgccagatgtcgattattggg
atgtagactttactaaacctgtcgagatgtttataaactacatagcaaagaaagatgtag
atattcaaaatttagataagtcatttattgaccgtatttttgatatatataattttaatg
acaatatagtacaagcagtacatagacaaagcatcggaactgtagataattttgcagacg
gaaaaatatctttttacataagaaatatagaagaatagtaggtgattatacaatgataat
tgattatgtttatttattaatatttgcattgtttattttgacaatttataaagtcgcaaa
gatagaaaataaatggggtttaatattgtatataggaacaataattatttgcttaataaa
aataataacaggagtgtgtagtatatgttagatgtaaatgaattaaagctgaaaaatata
agattttataaaggaagatatgttgttagattaatgagaagttataaaacactatctgaa
gcaaagaaattaaagaaattcttaaagcaatatataaattgtgttagtatatatcaaaca
aaaaatggatttatggtacaaacatataaagaatataaaactttagaagatgcaataaag
gtaagagattatttaacagaaaaattagaagaacgaaagagtgtagcttaatgtttataa
cgaaataaatatgttaggagagaattaatatgggaaagaaagttttggcgttaagtat


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
cmr|NT03CP1178 Clostridium perfringens 13     BRO family, N-terminus family
dbj|BAB80816.1 Clostridium perfringens str. 13     phage-related conserved hypothetical protein
fig|195102.1.peg.1173 Clostridium perfringens str. 13 FIG   kilA protein, putative phage-related DNA binding protein
gi|18144771 Clostridium perfringens str. 13 NCBI   phage-related conserved hypothetical protein
gi|18310092 Clostridium perfringens str. 13 NCBI   hypothetical protein CPE1110
img|637252465 Clostridium perfringens 13 IMG   hypothetical protein
kegg|cpe:CPE1110 Clostridium perfringens 13 KEGG   hypothetical protein
pathema|ntcp03.3.cds.ORF01296 Clostridium perfringens     BRO family, N-terminus family
ref|NP_562026.1 Clostridium perfringens str. 13 RefSeq   hypothetical protein CPE1110
tr|Q8XLD2 Clostridium perfringens TrEMBL   Putative uncharacterized protein CPE1110


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search