The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|195102.6.peg.1175: Clostridium perfringens str. 13

This feature in The SEED Viewer

NCBI Taxonomy Id: 195102

Current Assignment: FIG00526792: hypothetical protein
Translate Function Assignments



Context on contig NC_003366 from base 1298199 to 1312071 (13873 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1167 1298199 1299215 1017 +           DNA integration/recombination protein locus|CPE1095, protein_id|NP_562011.1, gi|18310077, geneID|989404
1168 1299873 1300172 300 + 657         no significant homology. locus|CPE1096, protein_id|NP_562012.1, gi|18310078, geneID|989405
1169 1300534 1300313 222 - 140         probable transcriptional regulator locus|CPE1097, protein_id|NP_562013.1, gi|18310079, geneID|989406
1170 1300712 1301176 465 + 177         no significant homology. locus|CPE1098, protein_id|NP_562014.1, gi|18310080, geneID|989407
1171 1301201 1301503 303 + 24         no significant homology. locus|CPE1099, protein_id|NP_562015.1, gi|18310081, geneID|989408
1172 1301594 1302286 693 + 90         FIG00514000: hypothetical protein locus|CPE1100, protein_id|NP_562016.1, gi|18310082, geneID|989409
1173 1302323 1302556 234 + 36         FIG00524621: hypothetical protein locus|CPE1101, protein_id|NP_562017.1, gi|18310083, geneID|989410
1174 1302601 1303431 831 + 44         no significant homology locus|CPE1102, protein_id|NP_562018.1, gi|18310084, geneID|989411
1175 1303510 1306695 3186 + 78         FIG00526792: hypothetical protein locus|CPE1103, protein_id|NP_562019.1, gi|18310085, geneID|989412
1176 1306777 1307226 450 + 81         no significant homology. locus|CPE1104, protein_id|NP_562020.1, gi|18310086, geneID|989413
1177 1307241 1307561 321 + 14         no significant homology. locus|CPE1105, protein_id|NP_562021.1, gi|18310087, geneID|989414
1178 1307575 1307745 171 + 13         no significant homology. locus|CPE1106, protein_id|NP_562022.1, gi|18310088, geneID|989415
1179 1307775 1308695 921 + 29         no significant homology. locus|CPE1107, protein_id|NP_562023.1, gi|18310089, geneID|989416
1180 1309065 1309247 183 + 369         no significant homology locus|CPE1108, protein_id|NP_562024.1, gi|18310090, geneID|989417
1181 1309449 1309904 456 + 201         FIG00526667: hypothetical protein locus|CPE1109, protein_id|NP_562025.1, gi|18310091, geneID|989418
1182 1310119 1311216 1098 + 214         kilA protein, putative phage-related DNA binding protein locus|CPE1110, protein_id|NP_562026.1, gi|18310092, geneID|989419
1183 1311383 1311649 267 + 166         FIG00522631: hypothetical protein locus|CPE1112, protein_id|NP_562028.1, gi|18310094, geneID|989421
1184 1311688 1312071 384 + 38         no significant homology. locus|CPE1113, protein_id|NP_562029.1, gi|18310095, geneID|989422

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|195102.6.peg.1175 FIG00526792: hypothetical protein
MKKLQQYKVSYVRNGEKAKDISLCQNVILEAFSIYNNIRYKNGEYIEDIIKVIFKDGEQL
ETLKNGLIYNEEKYVPLLTSPSMQKHEEKIGKKTYKMEYLFIKESKAEFRDILENILSLG
KSTEWEGKSMSIVKDVTARLGLATSGTHKINYTPKFIVLQDREYTYKQENYVAFTDNSLD
KVTPITPESHPEAYKHTMFDGSGLMSPKMAKIIQEQLGLDYNVDFAIIRGYNGLAIKGLC
LKFDFMKYIEDNYKEDSDNFKKENGVYKVKDYWGHWQKLDENIDLIFTESQAKWAKNFSS
MEEYLEARESFDKKYKTITDSLYITKTNKDPKKLKTHTTTDYQLLNNLVLNKDDLIELSK
ETVDYYKKIIDYDYDAVRLFLGDIATDIEVTENGEVENHSELSASSKIHSLIQLMNKKAL
SFKEVRRFIQNNITKKICQVAGGIFFLEGGYKIIAPCPITFCNVLLTGHRGDNGLAEKEF
YIAGWEGEKVTISRNPIACYQEIQKTILTDKLDKYCKDYTSEIIFFNQKDNTHMLMSGAD
EDGDGCKCFKNNILYNAVITPEKIFVNLSDGIENPKHIYSRKQRWENEVACSGNLIGKIA
NSTVIINSEAQASYYYYKKDLIARREAEANGEEFNLKKWTYRELFDKYGVAIVGSEEKWE
MYNTKDYSDEEWENKRQEFMDKQRKDFNKLLAKQLENKILIFEDTQKRHKKLIEKRFIEN
NIDSFRAIQLSMMAIDSPKTLRMPGKEDLELLECFAKAKKPYFLCMLKKDLRKKKTTNYR
TCLDLHAKYIAKELLSVNLSEEHINKVELKDGSNVKKLAAKSNDSLVKKYIKPYIDGKEV
EANEDLCNLIRLALDVQAGAKNSNMYNLDWIRKNMVLEEDEYTDEECYDLAKIYFIEQYQ
KLSKDLELETIVATLLKAKANSRFVLNVAWDDFERVLKELYKDTPYAYIENLNGEIDWMF
KKYSKIDTRFKDNNLIDKDRIAAEKRLGGLNKIGFKKTEEGFENSIETYTRLIFTREGFK
LNENKLGGFYEIPDLEDGQEVEVVEEPKIRQKSVHIVYKLI

MD5 = 4645b389e140e2e01aaa73f68190081d


  DNA Sequence

>fig|195102.6.peg.1175 FIG00526792: hypothetical protein
atgaagaaattacaacaatacaaagttagttacgttagaaatggagaaaaggcaaaggat
ataagtctttgtcagaacgttattttagaagcatttagtatttataataatataagatat
aagaacggagaatatatagaagatataataaaggttatttttaaagatggagaacaatta
gaaacacttaaaaatggactcatatacaacgaagagaaatatgtaccattattaacaagt
ccttctatgcaaaaacatgaagaaaaaattggtaagaaaacatacaaaatggaatattta
tttattaaagaatctaaagcagaatttagagatatattagaaaacatattaagcttaggt
aaatctacagagtgggaaggcaaaagcatgtctattgtaaaagatgttacagctagacta
ggtttagcaacatcaggtactcataagattaattacacacctaaatttatagtattacaa
gacagagaatatacatataaacaagaaaattatgtagcatttacagataatagcttagat
aaagtaactcctattactccagaaagtcatccagaagcttataaacatacaatgtttgat
ggtagcggtctaatgtctcctaaaatggcaaaaataatacaagaacaattaggattagat
tataatgtggattttgctattattaggggatataacggactagcaattaaaggtttatgc
cttaaatttgatttcatgaagtatatagaagataactataaagaagattcagataacttt
aagaaagaaaatggagtatataaggttaaagattattggggacattggcaaaaacttgat
gagaacatagatttaatttttacagaaagtcaagcaaaatgggctaagaatttctcaagt
atggaggaatatttagaagctagagaaagttttgataaaaaatataaaacaattactgat
agtttatatatcacaaaaactaataaagatcctaaaaaattaaaaacacataccactaca
gattatcaattacttaataatttagttcttaataaagatgaccttatagaattatccaaa
gaaaccgtagattattacaaaaagattatagattacgattacgatgctgtaagacttttt
ctaggagatatagctacagatatagaagtaactgagaatggagaagtagaaaatcattca
gaattaagtgcatctagtaaaatacatagccttatacagctcatgaataaaaaagcatta
tcttttaaagaagtaagaagatttatacaaaacaatataactaaaaaaatatgtcaagta
gctggaggaatattcttcttagaaggtggatataagattatagcaccttgtccaataact
ttttgtaatgtattgctaactggacacaggggagataatggactagcagaaaaagaattt
tatatagctggttgggaaggtgaaaaagttacaatatctcgtaatcctattgcatgttat
caagagatacaaaaaacaattcttacagataaattagataaatattgcaaagattatact
tcagaaataattttcttcaatcaaaaagacaatactcatatgctaatgagtggagctgat
gaagatggagatggatgtaaatgctttaagaataacatattatataacgcagtaattact
ccagaaaaaatatttgtaaatttatcagacggaatagaaaatcctaagcatatatatagt
agaaaacaacgttgggagaatgaagttgcttgctctggtaatcttataggaaagatcgct
aatagtaccgttattataaatagtgaagcacaagcaagttattattactataagaaagat
ttaatagcaagaagagaagcagaagcgaatggagaagaatttaacctaaagaaatggact
tatagagaattattcgataaatatggtgtagctatagttggtagcgaagaaaaatgggaa
atgtacaatacaaaagattatagcgatgaagaatgggaaaataagagacaagaatttatg
gataaacaaagaaaagattttaataaattattagcaaaacaattagaaaacaaaatatta
atatttgaagacacacaaaaaagacataagaaacttatagagaaaagatttatagaaaat
aatatagatagctttagagcaatacagttaagtatgatggcaattgattctcctaaaact
ctccgtatgcctggtaaagaagatttagaattattggaatgctttgctaaagctaagaag
ccatatttcttatgtatgctaaagaaagatttaagaaagaaaaaaactactaattataga
acttgtttggacttacatgctaaatacattgctaaagaattattaagtgttaatctatcc
gaagaacatattaataaagtagaacttaaagatggtagtaatgttaaaaaattagcagct
aaaagtaatgattcattagtaaaaaaatatattaaaccttatatagatggtaaagaagtc
gaggcaaacgaagatttatgcaatttaattagattagcattagatgtacaagctggagca
aaaaatagtaatatgtataatttagactggataagaaaaaacatggtgctagaagaagat
gaatatacagacgaagagtgttacgacttagctaaaatttactttatagaacaataccaa
aaactaagcaaagatttagagttggaaactatagttgctactttattaaaagctaaagct
aatagtagatttgtattaaatgttgcgtgggatgattttgaaagagttcttaaagagtta
tataaagatactccttatgcttatatagaaaatcttaatggagagatagactggatgttt
aagaagtattctaagatagatactagatttaaagacaataacttaatagataaagataga
atagcagcagaaaaaagattaggaggattaaataagataggctttaagaaaactgaagaa
ggatttgaaaatagtatagaaacatatacaagacttatatttactagagaaggatttaag
ctaaacgaaaataaattaggtggattctatgagatacctgatttagaagatggacaagaa
gtagaagtagtagaagaacctaaaattagacaaaaaagtgtacatatagtttataagtta
atataa


  DNA with Flanking Sequence

>fig|195102.6.peg.1175 FIG00526792: hypothetical protein
aaaaacccgaatatttatgtttatttgaatacaaggaagacgaatatttattggaaagag
attggagtggcgatttagaatattatactttagacgaagcaatagatgagtggatgggga
acgatgaagagaatatgatagaagaaagtaaatatgttgatgaggatagttattatatac
aactactattagagttacaaggatatcaagttgtaatattagaacgttcaagatttttgg
atcattcacatttagatgaaatatataagtatttaaaagaaggatacaaacttattagag
ctgtagaccttgcatatgttgaaaaagctgaaaagttagataaacaggatggatggtatg
acaatgaaagaagtatgcaaacatttgtaaacaattgtttatatacaacattagttaaat
agataaaatataatttaaatcaaaaggcttatacccaggtatgagccttataataactaa
aaaaggatgggatggaatttatgaagaaattacaacaatacaaagttagttacgttagaa
atggagaaaaggcaaaggatataagtctttgtcagaacgttattttagaagcatttagta
tttataataatataagatataagaacggagaatatatagaagatataataaaggttattt
ttaaagatggagaacaattagaaacacttaaaaatggactcatatacaacgaagagaaat
atgtaccattattaacaagtccttctatgcaaaaacatgaagaaaaaattggtaagaaaa
catacaaaatggaatatttatttattaaagaatctaaagcagaatttagagatatattag
aaaacatattaagcttaggtaaatctacagagtgggaaggcaaaagcatgtctattgtaa
aagatgttacagctagactaggtttagcaacatcaggtactcataagattaattacacac
ctaaatttatagtattacaagacagagaatatacatataaacaagaaaattatgtagcat
ttacagataatagcttagataaagtaactcctattactccagaaagtcatccagaagctt
ataaacatacaatgtttgatggtagcggtctaatgtctcctaaaatggcaaaaataatac
aagaacaattaggattagattataatgtggattttgctattattaggggatataacggac
tagcaattaaaggtttatgccttaaatttgatttcatgaagtatatagaagataactata
aagaagattcagataactttaagaaagaaaatggagtatataaggttaaagattattggg
gacattggcaaaaacttgatgagaacatagatttaatttttacagaaagtcaagcaaaat
gggctaagaatttctcaagtatggaggaatatttagaagctagagaaagttttgataaaa
aatataaaacaattactgatagtttatatatcacaaaaactaataaagatcctaaaaaat
taaaaacacataccactacagattatcaattacttaataatttagttcttaataaagatg
accttatagaattatccaaagaaaccgtagattattacaaaaagattatagattacgatt
acgatgctgtaagactttttctaggagatatagctacagatatagaagtaactgagaatg
gagaagtagaaaatcattcagaattaagtgcatctagtaaaatacatagccttatacagc
tcatgaataaaaaagcattatcttttaaagaagtaagaagatttatacaaaacaatataa
ctaaaaaaatatgtcaagtagctggaggaatattcttcttagaaggtggatataagatta
tagcaccttgtccaataactttttgtaatgtattgctaactggacacaggggagataatg
gactagcagaaaaagaattttatatagctggttgggaaggtgaaaaagttacaatatctc
gtaatcctattgcatgttatcaagagatacaaaaaacaattcttacagataaattagata
aatattgcaaagattatacttcagaaataattttcttcaatcaaaaagacaatactcata
tgctaatgagtggagctgatgaagatggagatggatgtaaatgctttaagaataacatat
tatataacgcagtaattactccagaaaaaatatttgtaaatttatcagacggaatagaaa
atcctaagcatatatatagtagaaaacaacgttgggagaatgaagttgcttgctctggta
atcttataggaaagatcgctaatagtaccgttattataaatagtgaagcacaagcaagtt
attattactataagaaagatttaatagcaagaagagaagcagaagcgaatggagaagaat
ttaacctaaagaaatggacttatagagaattattcgataaatatggtgtagctatagttg
gtagcgaagaaaaatgggaaatgtacaatacaaaagattatagcgatgaagaatgggaaa
ataagagacaagaatttatggataaacaaagaaaagattttaataaattattagcaaaac
aattagaaaacaaaatattaatatttgaagacacacaaaaaagacataagaaacttatag
agaaaagatttatagaaaataatatagatagctttagagcaatacagttaagtatgatgg
caattgattctcctaaaactctccgtatgcctggtaaagaagatttagaattattggaat
gctttgctaaagctaagaagccatatttcttatgtatgctaaagaaagatttaagaaaga
aaaaaactactaattatagaacttgtttggacttacatgctaaatacattgctaaagaat
tattaagtgttaatctatccgaagaacatattaataaagtagaacttaaagatggtagta
atgttaaaaaattagcagctaaaagtaatgattcattagtaaaaaaatatattaaacctt
atatagatggtaaagaagtcgaggcaaacgaagatttatgcaatttaattagattagcat
tagatgtacaagctggagcaaaaaatagtaatatgtataatttagactggataagaaaaa
acatggtgctagaagaagatgaatatacagacgaagagtgttacgacttagctaaaattt
actttatagaacaataccaaaaactaagcaaagatttagagttggaaactatagttgcta
ctttattaaaagctaaagctaatagtagatttgtattaaatgttgcgtgggatgattttg
aaagagttcttaaagagttatataaagatactccttatgcttatatagaaaatcttaatg
gagagatagactggatgtttaagaagtattctaagatagatactagatttaaagacaata
acttaatagataaagatagaatagcagcagaaaaaagattaggaggattaaataagatag
gctttaagaaaactgaagaaggatttgaaaatagtatagaaacatatacaagacttatat
ttactagagaaggatttaagctaaacgaaaataaattaggtggattctatgagatacctg
atttagaagatggacaagaagtagaagtagtagaagaacctaaaattagacaaaaaagtg
tacatatagtttataagttaatataaatgaaaataaatatgggctagaatgccctcagaa
gaacaagaaaagttttttaataatattggttgagtggacatcaaagagtgagggcttgtg
aagaaatgggaatattagaaataccatgtagaataactcactatcctgattatgatgaaa
aattcaataggactaaagatgatatgatacttgaagatttaatatcaacaaacataatgc
aaagaggtgttggaaatgttaatcctatgaaaatggctaaatgtattatggaacttgaga
ggattaagggaatttacaaaggtaatcatcaaaaagtgaagcaagataatcttacttcac
aatattcacaaaaagatatggctgaggaattaggaatcactagacaacaacttcaagatt
ataaaaaacttttaaatcttattcctgaactccaacaaatggttgagaatggttctatga
aggctacagtaggctataaaatatgggctaaaatgccacaggagga


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
cmr|NT03CP1171 Clostridium perfringens 13     hypothetical protein
pathema|ntcp03.3.cds.ORF01289 Clostridium perfringens     hypothetical protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search