The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|186103.3.peg.1131: Streptococcus pyogenes MGAS8232

This feature in The SEED Viewer

NCBI Taxonomy Id: 186103

Current Assignment: putative antirepressor - phage associated
Translate Function Assignments



Context on contig NC_003485 from base 1058296 to 1069464 (11169 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1120 1058592 1058296 297 -           conserved hypothetical protein - phage associated locus|spyM18_1259, protein_id|NP_607366.1, gi|19746230, geneID|993637
1121 1059014 1058655 360 - 62         conserved hypothetical protein - phage associated locus|spyM18_1260, protein_id|NP_607367.1, gi|19746231, geneID|993729
1122 1059672 1059067 606 - 52         Phage major tail protein locus|spyM18_1261, protein_id|NP_607368.1, gi|19746232, geneID|994902
1123 1060077 1059688 390 - 15         Structural protein locus|spyM18_1262, protein_id|NP_607369.1, gi|19746233, geneID|994059
1124 1060427 1060074 354 - -4         Phage protein locus|spyM18_1263, protein_id|NP_607370.1, gi|19746234, geneID|995031
1125 1060614 1060420 195 - -8         Phage protein locus|spyM18_1264, protein_id|NP_607371.1, gi|19746235, geneID|993468
1126 1061078 1060725 354 - 110         Phage protein locus|spyM18_1265, protein_id|NP_607372.1, gi|19746236, geneID|994384
1127 1061334 1061092 243 - 13         hypothetical phage protein locus|spyM18_1266, protein_id|NP_607373.1, gi|19746237, geneID|993666
1128 1062423 1061344 1080 - 9         Phage major capsid protein #Fam0021 locus|spyM18_1267, protein_id|NP_607374.1, gi|19746238, geneID|993984
1129 1062806 1062426 381 - 2         Phage major capsid protein #Fam0020 locus|spyM18_1268, protein_id|NP_607375.1, gi|19746239, geneID|993726
1130 1063349 1062816 534 - 9         Phage capsid and scaffold locus|spyM18_1269, protein_id|NP_607376.1, gi|19746240, geneID|993648
1131 1064204 1063461 744 - 111         putative antirepressor - phage associated locus|spyM18_1270, protein_id|NP_607377.1, gi|19746241, geneID|994003
1132 1064454 1064206 249 - 1         hypothetical protein locus|spyM18_1271, protein_id|NP_607378.1, gi|19746242, geneID|995017
1133 1064748 1064569 180 - 114         hypothetical phage protein locus|spyM18_1272, protein_id|NP_607379.1, gi|19746243, geneID|993446
1134 1065113 1064844 270 - 95         Phage protein locus|spyM18_1273, protein_id|NP_607380.1, gi|19746244, geneID|993728
1135 1065352 1065173 180 - 59         hypothetical protein locus|spyM18_1274, protein_id|NP_607381.1, gi|19746245, geneID|995024
1136 1066968 1065343 1626 - -10         Phage protein locus|spyM18_1275, protein_id|NP_607382.1, gi|19746246, geneID|994868
1137 1068451 1066949 1503 - -20         Phage portal locus|spyM18_1276, protein_id|NP_607383.1, gi|19746247, geneID|994242
1138 1069464 1068463 1002 - 11         Phage terminase, large subunit locus|spyM18_1277, protein_id|NP_607384.1, gi|19746248, geneID|993744

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|186103.3.peg.1131 putative antirepressor - phage associated
MELQVFTNEQFGEVRTADINGESFFNLKDCCKILEIKNSKDVVKRLNPKGVVTTDLLTNG
GTQQANFINESNFYKLVFQSRKPEAEKFADWVTSEVLPSIRKHGAYMTEQTLEQALTSPD
FLIRLANELKEEKERSRQLEAEKSILSVENMVMKPKADYFDDLVDRNLLTSFRETAKQLK
VKERRFIQFLLDKKYVYRDKKGKLMPFADKNSGLFEVKESVNEKTNWAGTQTLITPKGRE
TFRLLFI

MD5 = 2e55c935537e9115e174c2d9d9863f1a


  DNA Sequence

>fig|186103.3.peg.1131 putative antirepressor - phage associated
atggaattacaagtatttactaatgaacagtttggagaagtgcgtacagcagatattaac
ggagaatcgtttttcaatttgaaagactgctgtaaaattttagaaatcaaaaatagcaaa
gatgttgttaaacgacttaacccaaagggggtcgttactaccgacctccttacgaatggc
ggaactcaacaagctaacttcatcaacgaaagcaatttctacaagttagtcttccaatct
cgcaagccagaagctgaaaagtttgcagactgggtcacatcggaagtcctaccatcaatc
cgcaaacacggcgcttatatgactgaacaaaccttggaacaggcacttaccagcccagac
ttcctcatacggcttgccaatgagttaaaagaggaaaaggagcgcagtcgtcagttagag
gctgagaagtcaattttgagcgttgagaacatggttatgaagccaaaggctgattatttt
gatgatttggttgaccgcaatttattgactagtttccgtgaaactgctaaacaattaaaa
gttaaggaacgacgattcattcaatttctacttgataagaaatacgtttacagagacaag
aaaggtaagcttatgccgtttgcagataaaaatagcgggttatttgaagtcaaggaaagt
gttaacgaaaagaccaactgggcaggaactcaaaccttaataactccaaaaggtcgtgaa
acttttagactgttatttatttaa


  DNA with Flanking Sequence

>fig|186103.3.peg.1131 putative antirepressor - phage associated
tgtcgaagtcaaggcaagaattgattcagagttaaataaaaagctcgaacagtattgtca
agacaacaatactactcgaacagaggtagttagagatggtattaagctggtattaggcgt
aaataaacaaaaataggttagaacccccgtcgccaaactgtggttctaacctatcgcacg
aaagaaactctttctgaaatcattatatcagaatagagcttctttgtcatataccaaagg
agtttttattatggcgaaaattgatattattgataattatgagacattgctaattagtgt
cgaagaaattagagcaagtttggaatccttgcatgcctggctggataaagacattgattg
ggatagtcagtgtgattggtacgattttatttctcaacacagttcccaaattgcgattct
aaacttgattatgtaccgtttagacagtttagaagtggaacacagaagcgttatcgaaaa
cacaatgaaaggtaaataatatggaattacaagtatttactaatgaacagtttggagaag
tgcgtacagcagatattaacggagaatcgtttttcaatttgaaagactgctgtaaaattt
tagaaatcaaaaatagcaaagatgttgttaaacgacttaacccaaagggggtcgttacta
ccgacctccttacgaatggcggaactcaacaagctaacttcatcaacgaaagcaatttct
acaagttagtcttccaatctcgcaagccagaagctgaaaagtttgcagactgggtcacat
cggaagtcctaccatcaatccgcaaacacggcgcttatatgactgaacaaaccttggaac
aggcacttaccagcccagacttcctcatacggcttgccaatgagttaaaagaggaaaagg
agcgcagtcgtcagttagaggctgagaagtcaattttgagcgttgagaacatggttatga
agccaaaggctgattattttgatgatttggttgaccgcaatttattgactagtttccgtg
aaactgctaaacaattaaaagttaaggaacgacgattcattcaatttctacttgataaga
aatacgtttacagagacaagaaaggtaagcttatgccgtttgcagataaaaatagcgggt
tatttgaagtcaaggaaagtgttaacgaaaagaccaactgggcaggaactcaaaccttaa
taactccaaaaggtcgtgaaacttttagactgttatttatttaattcactttaaagtcgt
agcaatacggctttttattatgtccaagcattgacgacgtaaaaagctatggattttata
gtcggggacgacttaaaacataggaggtgccaaccatggcagaagaaacacaaacagttg
aaacggttgaagagcaagtggtaccagaagcaaaacaaccgcaagacgaaaaaaagtaca
cagatgcagatgtggatgccatcatcgacaaaaaatttgcaaagtggaagtcagaacaag
aagcggagaaatcggaagctaaaaaaatggctaagatgaatgagaaagagaaagcagaat
acgaaaagcagaagctgttagacgaattgcaagagctaaaaaacgataagacacgcaatg
agttaacagcagtagctcgtcaaatgtttgcagaatctgaaatcaacgtcaacgatgacg
tacttggtttagttgtgactttggacgcagaacaaacaaaagcaaatgtaacaacgctag
caaa


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0003677       F:DNA binding
cmr|NT03SP1185 Streptococcus pyogenes MGAS8232     bacteriophage L54a, antirepressor, putative
fig|186103.1.peg.1040 Streptococcus pyogenes MGAS8232 FIG   putative antirepressor - phage associated
gb|AAL97876.1 Streptococcus pyogenes MGAS8232     putative antirepressor
gi|19746241 Streptococcus pyogenes MGAS8232 NCBI   putative antirepressor
gi|19748427 Streptococcus pyogenes MGAS8232 NCBI   putative antirepressor
img|637260790 Streptococcus pyogenes MGAS8232 IMG   putative antirepressor
kegg|spm:spyM18_1270 Streptococcus pyogenes MGAS8232 (serotype M18) KEGG   putative antirepressor
ref|NP_607377.1 Streptococcus pyogenes MGAS8232 RefSeq   putative antirepressor
tr|Q8P0P5 Streptococcus pyogenes serotype M18 TrEMBL   Putative antirepressor


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search