The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|186103.3.peg.1130: Streptococcus pyogenes MGAS8232

This feature in The SEED Viewer

NCBI Taxonomy Id: 186103

Current Assignment: Phage capsid and scaffold
Translate Function Assignments



Context on contig NC_003485 from base 1056794 to 1068451 (11658 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1119 1058281 1056794 1488 -           Phage tail length tape-measure protein locus|spyM18_1258, protein_id|NP_607365.1, gi|19746229, geneID|995021
1120 1058592 1058296 297 - 14         conserved hypothetical protein - phage associated locus|spyM18_1259, protein_id|NP_607366.1, gi|19746230, geneID|993637
1121 1059014 1058655 360 - 62         conserved hypothetical protein - phage associated locus|spyM18_1260, protein_id|NP_607367.1, gi|19746231, geneID|993729
1122 1059672 1059067 606 - 52         Phage major tail protein locus|spyM18_1261, protein_id|NP_607368.1, gi|19746232, geneID|994902
1123 1060077 1059688 390 - 15         Structural protein locus|spyM18_1262, protein_id|NP_607369.1, gi|19746233, geneID|994059
1124 1060427 1060074 354 - -4         Phage protein locus|spyM18_1263, protein_id|NP_607370.1, gi|19746234, geneID|995031
1125 1060614 1060420 195 - -8         Phage protein locus|spyM18_1264, protein_id|NP_607371.1, gi|19746235, geneID|993468
1126 1061078 1060725 354 - 110         Phage protein locus|spyM18_1265, protein_id|NP_607372.1, gi|19746236, geneID|994384
1127 1061334 1061092 243 - 13         hypothetical phage protein locus|spyM18_1266, protein_id|NP_607373.1, gi|19746237, geneID|993666
1128 1062423 1061344 1080 - 9         Phage major capsid protein #Fam0021 locus|spyM18_1267, protein_id|NP_607374.1, gi|19746238, geneID|993984
1129 1062806 1062426 381 - 2         Phage major capsid protein #Fam0020 locus|spyM18_1268, protein_id|NP_607375.1, gi|19746239, geneID|993726
1130 1063349 1062816 534 - 9       Phage capsid and scaffold locus|spyM18_1269, protein_id|NP_607376.1, gi|19746240, geneID|993648
1131 1064204 1063461 744 - 111         putative antirepressor - phage associated locus|spyM18_1270, protein_id|NP_607377.1, gi|19746241, geneID|994003
1132 1064454 1064206 249 - 1         hypothetical protein locus|spyM18_1271, protein_id|NP_607378.1, gi|19746242, geneID|995017
1133 1064748 1064569 180 - 114         hypothetical phage protein locus|spyM18_1272, protein_id|NP_607379.1, gi|19746243, geneID|993446
1134 1065113 1064844 270 - 95         Phage protein locus|spyM18_1273, protein_id|NP_607380.1, gi|19746244, geneID|993728
1135 1065352 1065173 180 - 59         hypothetical protein locus|spyM18_1274, protein_id|NP_607381.1, gi|19746245, geneID|995024
1136 1066968 1065343 1626 - -10 7     Phage protein locus|spyM18_1275, protein_id|NP_607382.1, gi|19746246, geneID|994868
1137 1068451 1066949 1503 - -20 4     Phage portal locus|spyM18_1276, protein_id|NP_607383.1, gi|19746247, geneID|994242

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|186103.3.peg.1130 Phage capsid and scaffold
MAEETQTVETVEEQVVPEAKQPQDEKKYTDADVDAIIDKKFAKWKSEQEAEKSEAKKMAK
MNEKEKAEYEKQKLLDELQELKNDKTRNELTAVARQMFAESEINVNDDVLGLVVTLDAEQ
TKANVTTLANAFAKVIADDRKALVRQTTPSTGGGVAKQTNYGANLASKAAQQSTKLF

MD5 = 4221e8e6e0046361c335a2473de81fa0


  DNA Sequence

>fig|186103.3.peg.1130 Phage capsid and scaffold
atggcagaagaaacacaaacagttgaaacggttgaagagcaagtggtaccagaagcaaaa
caaccgcaagacgaaaaaaagtacacagatgcagatgtggatgccatcatcgacaaaaaa
tttgcaaagtggaagtcagaacaagaagcggagaaatcggaagctaaaaaaatggctaag
atgaatgagaaagagaaagcagaatacgaaaagcagaagctgttagacgaattgcaagag
ctaaaaaacgataagacacgcaatgagttaacagcagtagctcgtcaaatgtttgcagaa
tctgaaatcaacgtcaacgatgacgtacttggtttagttgtgactttggacgcagaacaa
acaaaagcaaatgtaacaacgctagcaaacgcatttgctaaagttatcgctgatgaccgc
aaggctcttgtacgccagaccactccgtcaacaggcggtggtgtcgcaaaacaaaccaat
tacggtgctaacttggctagtaaggcagcacaacaaagcaccaagcttttttag


  DNA with Flanking Sequence

>fig|186103.3.peg.1130 Phage capsid and scaffold
cagacttcctcatacggcttgccaatgagttaaaagaggaaaaggagcgcagtcgtcagt
tagaggctgagaagtcaattttgagcgttgagaacatggttatgaagccaaaggctgatt
attttgatgatttggttgaccgcaatttattgactagtttccgtgaaactgctaaacaat
taaaagttaaggaacgacgattcattcaatttctacttgataagaaatacgtttacagag
acaagaaaggtaagcttatgccgtttgcagataaaaatagcgggttatttgaagtcaagg
aaagtgttaacgaaaagaccaactgggcaggaactcaaaccttaataactccaaaaggtc
gtgaaacttttagactgttatttatttaattcactttaaagtcgtagcaatacggctttt
tattatgtccaagcattgacgacgtaaaaagctatggattttatagtcggggacgactta
aaacataggaggtgccaaccatggcagaagaaacacaaacagttgaaacggttgaagagc
aagtggtaccagaagcaaaacaaccgcaagacgaaaaaaagtacacagatgcagatgtgg
atgccatcatcgacaaaaaatttgcaaagtggaagtcagaacaagaagcggagaaatcgg
aagctaaaaaaatggctaagatgaatgagaaagagaaagcagaatacgaaaagcagaagc
tgttagacgaattgcaagagctaaaaaacgataagacacgcaatgagttaacagcagtag
ctcgtcaaatgtttgcagaatctgaaatcaacgtcaacgatgacgtacttggtttagttg
tgactttggacgcagaacaaacaaaagcaaatgtaacaacgctagcaaacgcatttgcta
aagttatcgctgatgaccgcaaggctcttgtacgccagaccactccgtcaacaggcggtg
gtgtcgcaaaacaaaccaattacggtgctaacttggctagtaaggcagcacaacaaagca
ccaagcttttttaggaggaaattatgaacaaacgtaaagtaataacatctaaagagattc
tacacaatctcgactatgaggctatttcagtcactttagattcagaaaaaatcgacaaga
aagttgttccagctgggacagtattagcaggtgtctcggaatcagtatttaaaaaccgcg
aacagaaagttaaaactgtgaaaaatggagaaatttctagcgaaaacaacatctgcggga
ttttgcttacagatgtcgatttaacaaatggcgatgcagctggttcctgtgtttatcgtg
gcactgtcaatgcagacaagctcgcagacgcgacactggcaaaggatttcacgccgttgg
aaaaaaaactaccgcatattgtatttgttaaaggaggtaaataaatatggcgttaatcca
tgaaattatcacatcggaaaatatcaaaggtttttacaatgctaaaaacgaaaatgttga
aaatacattgggagaaaaagcattcccaccaaaa


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
cmr|NT03SP1184 Streptococcus pyogenes MGAS8232     BH3529~unknown
fig|186103.1.peg.1039 Streptococcus pyogenes MGAS8232 FIG   Phage capsid and scaffold
gb|AAL97875.1 Streptococcus pyogenes MGAS8232     hypothetical phage protein
gi|19746240 Streptococcus pyogenes MGAS8232 NCBI   hypothetical protein spyM18_1269
gi|19748425 Streptococcus pyogenes MGAS8232 NCBI   hypothetical phage protein
img|637260789 Streptococcus pyogenes MGAS8232 IMG   hypothetical protein
kegg|spm:spyM18_1269 Streptococcus pyogenes MGAS8232 (serotype M18) KEGG   hypothetical protein
ref|NP_607376.1 Streptococcus pyogenes MGAS8232 RefSeq   hypothetical protein spyM18_1269
tr|Q8P0P6 Streptococcus pyogenes serotype M18 TrEMBL   Hypothetical phage protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function
7 fig|186103.3.peg.1136 Phage protein
4 fig|186103.3.peg.1137 Phage portal


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search