The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|186103.3.peg.1122: Streptococcus pyogenes MGAS8232

This feature in The SEED Viewer

NCBI Taxonomy Id: 186103

Current Assignment: Phage major tail protein
Translate Function Assignments



Context on contig NC_003485 from base 1053834 to 1064748 (10915 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1117 1054613 1053834 780 -           Phage tail fibers locus|spyM18_1256, protein_id|NP_607363.1, gi|19746227, geneID|994383
1118 1056660 1054645 2016 - 31         putative minor tail protein locus|spyM18_1257, protein_id|NP_607364.1, gi|19746228, geneID|995050
1119 1058281 1056794 1488 - 133         Phage tail length tape-measure protein locus|spyM18_1258, protein_id|NP_607365.1, gi|19746229, geneID|995021
1120 1058592 1058296 297 - 14         conserved hypothetical protein - phage associated locus|spyM18_1259, protein_id|NP_607366.1, gi|19746230, geneID|993637
1121 1059014 1058655 360 - 62         conserved hypothetical protein - phage associated locus|spyM18_1260, protein_id|NP_607367.1, gi|19746231, geneID|993729
1122 1059672 1059067 606 - 52         Phage major tail protein locus|spyM18_1261, protein_id|NP_607368.1, gi|19746232, geneID|994902
1123 1060077 1059688 390 - 15         Structural protein locus|spyM18_1262, protein_id|NP_607369.1, gi|19746233, geneID|994059
1124 1060427 1060074 354 - -4         Phage protein locus|spyM18_1263, protein_id|NP_607370.1, gi|19746234, geneID|995031
1125 1060614 1060420 195 - -8         Phage protein locus|spyM18_1264, protein_id|NP_607371.1, gi|19746235, geneID|993468
1126 1061078 1060725 354 - 110         Phage protein locus|spyM18_1265, protein_id|NP_607372.1, gi|19746236, geneID|994384
1127 1061334 1061092 243 - 13         hypothetical phage protein locus|spyM18_1266, protein_id|NP_607373.1, gi|19746237, geneID|993666
1128 1062423 1061344 1080 - 9         Phage major capsid protein #Fam0021 locus|spyM18_1267, protein_id|NP_607374.1, gi|19746238, geneID|993984
1129 1062806 1062426 381 - 2         Phage major capsid protein #Fam0020 locus|spyM18_1268, protein_id|NP_607375.1, gi|19746239, geneID|993726
1130 1063349 1062816 534 - 9         Phage capsid and scaffold locus|spyM18_1269, protein_id|NP_607376.1, gi|19746240, geneID|993648
1131 1064204 1063461 744 - 111         putative antirepressor - phage associated locus|spyM18_1270, protein_id|NP_607377.1, gi|19746241, geneID|994003
1132 1064454 1064206 249 - 1         hypothetical protein locus|spyM18_1271, protein_id|NP_607378.1, gi|19746242, geneID|995017
1133 1064748 1064569 180 - 114         hypothetical phage protein locus|spyM18_1272, protein_id|NP_607379.1, gi|19746243, geneID|993446

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|186103.3.peg.1122 Phage major tail protein
MSEAQEQTKQLEAKQGIHSILLFRLLKEASSEVATKLAFQTEHEVGKSRDVDGQKTKDGI
IQSVGALEYDFKATSILAKGDTLAAKLEKAMEDGELVEIWDIDSEEASKKNDENGIAKVW
DIKNGTNGGENKYLATYYQGYISSFSAKKNAEENIVIEMEFAINGVGKKGLATLTNDQKK
AVQYAFKDTTSETKKENSFEM

MD5 = 1ae8c18f37012ffa66aa1766213090f5


  DNA Sequence

>fig|186103.3.peg.1122 Phage major tail protein
atgtcagaagcacaagaacaaacaaaacaattagaagcaaaacaaggaattcattcaatc
ttgttatttcgtttgttaaaagaagcatctagtgaggtagcaactaaactagcttttcaa
acagaacacgaagttggtaaaagccgtgacgtagatggacaaaaaactaaagatggtatt
atccagtccgtgggggctttagaatacgactttaaagcaacatctattttagctaaaggt
gacacactagcagctaaactagaaaaagccatggaggatggtgagcttgtagaaatttgg
gatattgattcagaagaagcaagcaaaaaaaacgacgaaaatgggattgcaaaagtttgg
gatattaagaatgggacaaacggaggagaaaataaatacctagcgacttattaccaaggt
tacatttcaagcttcagcgctaagaaaaacgcagaagaaaatattgtaattgaaatggag
tttgccatcaatggtgttggtaaaaaagggctcgctacattaacaaatgaccaaaaaaaa
gctgtacagtacgcatttaaagatacaaccagcgaaaccaaaaaagaaaacagctttgaa
atgtaa


  DNA with Flanking Sequence

>fig|186103.3.peg.1122 Phage major tail protein
agaggaactcgccttatgagcaaacaaccgtttgttttgccagctctaaaagagcaaaaa
gtaaaatttagaaaagatttggaggcgcttgtcaaatgattaaaactagagatcagtcta
tttttgatgaaatgtttaaacgtatccagtctttaggctttacagtttacgattataaac
cgatgactgaagttccatatccatttgtggaaatggaatctactgatgcggagtatattc
caaataaagatgacattaaaggttctgttgaacttatgttgtctgtttggggattgcaga
aaaaacggaagcaggtgtctgacatggcatctgctattttttcgcaagctatgtccgtag
ctcgtaccgatggattctgttggtcgtttaatattaggcagtcgtctgttcagattttgg
acgatacaacaactgtgacacttcttaaacgagcgattgtcacacttagatttaatttga
gataggaggagaaagaagtaatgtcagaagcacaagaacaaacaaaacaattagaagcaa
aacaaggaattcattcaatcttgttatttcgtttgttaaaagaagcatctagtgaggtag
caactaaactagcttttcaaacagaacacgaagttggtaaaagccgtgacgtagatggac
aaaaaactaaagatggtattatccagtccgtgggggctttagaatacgactttaaagcaa
catctattttagctaaaggtgacacactagcagctaaactagaaaaagccatggaggatg
gtgagcttgtagaaatttgggatattgattcagaagaagcaagcaaaaaaaacgacgaaa
atgggattgcaaaagtttgggatattaagaatgggacaaacggaggagaaaataaatacc
tagcgacttattaccaaggttacatttcaagcttcagcgctaagaaaaacgcagaagaaa
atattgtaattgaaatggagtttgccatcaatggtgttggtaaaaaagggctcgctacat
taacaaatgaccaaaaaaaagctgtacagtacgcatttaaagatacaaccagcgaaacca
aaaaagaaaacagctttgaaatgtaacggttaggttggatttagtatccaaccttttatt
gttgaaggagaaagaataatgcaattggaaattaaaggaaaaactcataacgtaaaattt
ggcacacgatttgttgctgaaatggataaagctcatgttacagaacgtgaggggatgaaa
tttggtactggtttacaatcaacggttccgtttttgtttgaacgtaatgttgtgacactt
gccgaaatcattcatgttggaaccattacagaatcacctcgtccaagcttgaacgacatt
tatgactacattgatgaggtcgaagatatcgaaaaacttttcaatgatgttctagacgag
ttacgtcagtcaaacgcttcaaagttatttatcgccaaactggacaaaaacatggcggaa
atggaagcagaggcttaaaacattattcttctcaagaaagctttgagatgattgtgctta
attgtattagatatctcggcatgactgacatcaatgaaatcgggcg


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
cmr|NT03SP1176 Streptococcus pyogenes MGAS8232     gp168
fig|186103.1.peg.1031 Streptococcus pyogenes MGAS8232 FIG   Phage major tail protein
gb|AAL97867.1 Streptococcus pyogenes MGAS8232     putative structural phage protein
gi|19746232 Streptococcus pyogenes MGAS8232 NCBI   putative structural phage protein
gi|19748417 Streptococcus pyogenes MGAS8232 NCBI   putative structural phage protein
img|637260781 Streptococcus pyogenes MGAS8232 IMG   putative structural phage protein
kegg|spm:spyM18_1261 Streptococcus pyogenes MGAS8232 (serotype M18) KEGG   putative structural phage protein
ref|NP_607368.1 Streptococcus pyogenes MGAS8232 RefSeq   putative structural phage protein
tr|Q8P0Q4 Streptococcus pyogenes serotype M18 TrEMBL   Putative structural phage protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search