The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|169963.1.peg.2315: Listeria monocytogenes EGD-e

This feature in The SEED Viewer

NCBI Taxonomy Id: 169963

Current Assignment: Phage antirepressor protein
Translate Function Assignments



Context on contig NC_003210 from base 2361141 to 2402366 (41226 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
2306 2391816 2391220 597 -       1: 1 ff
isu
Phage A118 gp51 protein homolog lmo2315, NP_465839.1, gi|16804354, GeneID:984491
2307 2392625 2391813 813 - -4       ff Phage DNA adenine methylase (EC 2.1.1.72) lmo2316, NP_465840.1, gi|16804355, CDD:pfam02086, GeneID:984490
2308 2393596 2392622 975 - -4     1: 1 ff
isu
Phage replication initiation protein lmo2317, NP_465841.1, gi|16804356, GeneID:984715
2309 2394311 2393613 699 - 16     1: 3   Phage essential recombination function protein, Erf lmo2318, NP_465842.1, gi|16804357, GeneID:984489
2310 2394793 2394317 477 - 5       ff Phage protein lmo2319, NP_465843.1, gi|16804358, GeneID:984557
2311 2394984 2394790 195 - -4       ff FIG00774562: hypothetical protein lmo2320, NP_465844.1, gi|16804359, GeneID:986602
2312 2395478 2395290 189 - 305     1: 1 ff
isu
Phage A118 gp49 protein homolog lmo2321, NP_465845.1, gi|16804360, GeneID:984486
2313 2395801 2395586 216 - 107     1: 1 ff
isu
Phage A118 gp48 protein homolog lmo2322, NP_465846.1, gi|16804361, GeneID:984678
2314 2396331 2395798 534 - -4     1: 1 ff
isu
Phage A118 gp43 protein homolog lmo2323, NP_465847.1, gi|16804362, GeneID:986266
2315 2397230 2396454 777 - 122     2: 4 1 ff
isu
Phage antirepressor protein lmo2324, NP_465848.1, gi|16804363, GeneID:986505
2316 2397487 2397212 276 - -19     1: 2   hypothetical protein lmo2325, NP_465849.1, gi|16804364, GeneID:984475
2317 2397774 2397493 282 - 5     1: 1 ff
isu
Phage A118 gp41 protein homolog lmo2326, NP_465850.1, gi|16804365, GeneID:984477
2318 2398084 2397800 285 - 25       ff FIG00774252: hypothetical protein lmo2327, NP_465851.1, gi|16804366, GeneID:984480
2319 2398529 2398287 243 - 202     1: 1 ff
isu
Phage transcriptional regulator cro lmo2328, NP_465852.1, gi|16804367, CDD:pfam01381, CDD:smart00530, GeneID:988011
2320 2398685 2399161 477 + 155     1: 1 ff
isu
Phage repressor protein cI lmo2329, NP_465853.1, gi|16804368, CDD:pfam01381, CDD:smart00530, GeneID:988012
2321 2399542 2400243 702 + 380     1: 1 ff
isu
Phage A118 gp33 protein homolog lmo2330, NP_465854.1, gi|16804369, GeneID:985317
2322 2400264 2400944 681 + 20       ff Phage A118 gp32 protein homolog lmo2331, NP_465855.1, gi|16804370, GeneID:985570
2323 2401008 2402366 1359 + 63     1: 1 ff
isu
Phage DNA recombinase int, lmo2332, NP_465856.1, gi|16804371, CDD:pfam00239, GeneID:986704

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
Listeria_phi-A118-like_prophages SvetaG Antirepressor [Bacteriophage A118]
Phage_experimental RamyA Phage antirepressor protein


  Protein Sequence

>fig|169963.1.peg.2315 Phage antirepressor protein
MSNLQVIANEMLPVLENEQGEKFVDARMLHEKLLVNTRFNDWIYRMIGNYGYENGLDFYS
TLSKTNGRPSTNYFLTLDTAKELAMVQNNEMGRAIRKYFIEVEKQARKLATEYPAFSYMI
EDPVARAKKWIEEQQEKQEVLKKLEEQKPKVVFAEAVQTSENTILVKDLATILKQKGLDI
GQNRLFEWLRGSGYLLSKGAYYNKPSQKAMNLGLFEQKTHIHTDRNGLMKTTYTPQVTGK
GQVYLLNKLLEEHNQVII

MD5 = 03b5d6d3b0e66520e63f78414f4391e6


  DNA Sequence

>fig|169963.1.peg.2315 Phage antirepressor protein
atgtcaaatttacaagtaattgcaaatgaaatgttgccagttttagaaaatgaacaaggc
gaaaaatttgttgatgcccggatgcttcatgaaaagcttttagtaaatacaagatttaat
gattggatatatagaatgattggaaattatggttatgagaatggtttagacttttactca
actttgagtaaaaccaatgggcgaccatcaacaaattattttttgactttagatactgct
aaagaattagcaatggtgcaaaacaacgaaatgggtcgagcaattagaaaatacttcatt
gaagtagaaaaacaagcgaggaaattagcaactgaatatcccgcattttcatacatgata
gaagatccagtcgctagagctaaaaaatggatagaggaacaacaagaaaagcaagaggtg
ttaaaaaaacttgaggaacaaaagccgaaagtagtttttgcggaagctgtgcaaacgagt
gagaacacaattttagtaaaagatttagctactattctaaaacaaaaaggattagatata
ggacaaaacaggctttttgaatggctgagaggaagcggttatttgctaagtaaaggtgct
tattacaacaaaccgtcgcaaaaggcgatgaacttaggattgtttgaacaaaaaacacat
attcatacagatagaaacggcttaatgaaaaccacttatactccacaagtaacaggaaaa
ggacaagtatatctattaaacaagttattagaagaacacaatcaagtcataatttaa


  DNA with Flanking Sequence

>fig|169963.1.peg.2315 Phage antirepressor protein
agaaaatggtaatgcgatagagagcggctcattcgttaaatacagcgttataaaaaatat
tttaagtttacttgaaaaagatcaagagctaaaaattatcgaaatgaaagtagagctgaa
tggagtagaggattccatagaaaacgccactttgttagaaaagagattaattgaagccaa
atctttggtggaagacttggctagcactataaactcgttagaaattaaggtgaagtgatt
tacttgatttttacagtaaattcattcccgcaatcgggacatgtgtttactccaggttta
actgtaaatacatgcgaacattcgggacagctcccttccgttccatttttaataatatct
tgctttgcgatttttaggctttgttctttaatttgtctctctaatttttttgaatcaaat
ttaattttaactcccattttacccacctcccttcacaaaaactatagcactgtgaaaggg
cgaacagaaaggagaacaaaatgtcaaatttacaagtaattgcaaatgaaatgttgccag
ttttagaaaatgaacaaggcgaaaaatttgttgatgcccggatgcttcatgaaaagcttt
tagtaaatacaagatttaatgattggatatatagaatgattggaaattatggttatgaga
atggtttagacttttactcaactttgagtaaaaccaatgggcgaccatcaacaaattatt
ttttgactttagatactgctaaagaattagcaatggtgcaaaacaacgaaatgggtcgag
caattagaaaatacttcattgaagtagaaaaacaagcgaggaaattagcaactgaatatc
ccgcattttcatacatgatagaagatccagtcgctagagctaaaaaatggatagaggaac
aacaagaaaagcaagaggtgttaaaaaaacttgaggaacaaaagccgaaagtagtttttg
cggaagctgtgcaaacgagtgagaacacaattttagtaaaagatttagctactattctaa
aacaaaaaggattagatataggacaaaacaggctttttgaatggctgagaggaagcggtt
atttgctaagtaaaggtgcttattacaacaaaccgtcgcaaaaggcgatgaacttaggat
tgtttgaacaaaaaacacatattcatacagatagaaacggcttaatgaaaaccacttata
ctccacaagtaacaggaaaaggacaagtatatctattaaacaagttattagaagaacaca
atcaagtcataatttaagcgccgcctaccacaacgacgcttatacagacaacttagtcac
tggggagcgactaacaatagtatataacgataagttgttaattagtcgctaaaaaataaa
caaaaaggattgagatattatgtttcaaaaatcaacatcagcaacagccgcgatgcaagt
tttagcagaaactcgcacgcaaaaagagctagcgatagatagttatgtaacgccagcgtt
aataagtaatcagataaaaggaaaacgtactgtttcactagagcaagcagaacagctaat
tgatagttacaacgaaccgcgaagtacttacttgtttgcacatgaattcagcaacggaat
gataccaccgctttttgacggtttagacaaccatcacgcttctttaactaacagatttga
actagaagttgaagaagcgatgaacacgctaaaaaacggcttagagacgatgacgttcaa
tttaagaaaaggtgacatgttacaacgagaagcagct


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0003677       F:DNA binding
cmr|NT01LM2492 Listeria monocytogenes EGD-e     P1-antirepressor homolog
emb|CAD00402.1 Listeria monocytogenes EMBL   lmo2324
fig|169963.11.peg.2380 Listeria monocytogenes EGD-e FIG   Phage antirepressor protein
fig|267409.1.peg.1337 Listeria monocytogenes str. 1/2a F6854 FIG   Phage antirepressor protein
fig|267409.5.peg.1358 Listeria monocytogenes str. 1/2a F6854 FIG   Phage antirepressor protein
gb|EAL06553.1 Listeria monocytogenes str. 1/2a F6854     Phage antirepressor protein subfamily, putative
gi|16411813 Listeria monocytogenes NCBI   lmo2324
gi|16804363 Listeria monocytogenes EGD-e NCBI   hypothetical protein lmo2324
gi|47015622 Listeria monocytogenes str. 1/2a F6854 NCBI   Phage antirepressor protein subfamily, putative
gi|47096025 Listeria monocytogenes str. 1/2a F6854 NCBI   Phage antirepressor protein subfamily, putative
img|637222157 Listeria monocytogenes EGD-e IMG   hypothetical protein
img|638423944 Listeria monocytogenes 1/2a F6854 IMG   Phage antirepressor protein subfamily, putative
kegg|lmo:lmo2324 Listeria monocytogenes EGD-e (serotype 1/2a) KEGG   hypothetical protein
ref|NP_465848.1 Listeria monocytogenes EGD-e RefSeq   hypothetical protein lmo2324
ref|ZP_00233627.1 Listeria monocytogenes str. 1/2a F6854 RefSeq   Phage antirepressor protein subfamily, putative
tr|Q4ES42 Listeria monocytogenes str. 1/2a F6854 TrEMBL   Phage antirepressor protein subfamily, putative
tr|Q8Y4V6 Listeria monocytogenes TrEMBL   Lmo2324 protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value
CDD::33443 980.300;115-252
CDD::43300 950.500;124-253
CELLO::cytoplasm 4.034
evidence_code ff
evidence_code isu;Listeria_phi-A118-like_prophages
GO GO:0003677 DNA binding
in_phage List-M2
IPR::IPR005039 911.100;122-255
IPR::IPR005039 963.200;24-89
isoelectric_point 9.23
molecular_weight 29913
PFAM::PF03374 911.330;122-255
PFAM::PF08346 963.250;24-89
PSORT::Cytoplasmic 8.87
PSORT_score::Cytoplasmic 8.87
similar_to_human no


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   Listeria EGD-e -Institut Pasteur  |   RNAFold  |

> Show tool descriptions


FIG search