The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
 The SEED


FIG search

Protein fig|158879.11.peg.174: Staphylococcus aureus subsp. aureus N315

This feature in The SEED Viewer

NCBI Taxonomy Id: 158879

Current Assignment: FIG01108032: hypothetical protein
Translate Function Assignments


Context on contig NC_002745 from base 182832 to 195111 (12280 bp)

Fid Start End Size
(nt)		   Gap Find
best
clusters		 Pins Fc-sc SS Ev Function Aliases
164 182832 183977 1146 +           Capsular polysaccharide synthesis enzyme Cap8P gene_name|capP, locus|SA0159, protein_id|NP_373401.1, gi|15925868, geneID|1122934
165 184368 184042 327 - 64     1: 1 dlit(14570922)
dlit(15520015)		 Heme-degrading monooxygenase, staphylobilin-producing (EC 1.14.99.48) # IsdI locus|SA0160, protein_id|NP_373402.1, gi|15925869, geneID|1122935
166 184758 184375 384 - 6     1: 1   Inner membrane protein YbaN locus|SA0161, protein_id|NP_373403.1, gi|15925870, geneID|1122936
167 185185 186672 1488 + 426     3: 6 8 9   Aldehyde dehydrogenase B (EC 1.2.1.22) gene_name|aldA, locus|SA0162, protein_id|NP_373404.1, gi|15925871, geneID|1122937
168 187319 188278 960 + 646     3: 3 10 7   Cobalt-zinc-cadmium resistance protein locus|SA0163, protein_id|NP_373405.1, gi|15925872, geneID|1122938
169 188407 188270 138 - -9         hypothetical protein  
170 188346 188525 180 + -62         hypothetical protein  
171 188543 188388 156 - -138         hypothetical protein locus|SAS005, protein_id|NP_373406.1, gi|15925873, geneID|1122939
172 188438 188590 153 + -106         hypothetical protein  
173 188776 188573 204 - -18         FIG01108246: hypothetical protein locus|SA0164, protein_id|NP_373407.1, gi|15925874, geneID|1122940
174 188955 189467 513 + 178         FIG01108032: hypothetical protein locus|SA0165, protein_id|NP_373408.1, gi|15925875, geneID|1122941
175 189809 190549 741 + 341         ABC transporter, ATP-binding protein locus|SA0166, protein_id|NP_373409.1, gi|15925876, geneID|1122942
176 190563 191534 972 + 13         FIG01108009: hypothetical protein locus|SA0167, protein_id|NP_373410.1, gi|15925877, geneID|1122943
177 191531 192292 762 + -4         ABC transporter, permease protein (cluster 10, nitrate/sulfonate/bicarbonate) locus|SA0168, protein_id|NP_373411.1, gi|15925878, geneID|1122944
178 192302 193336 1035 + 9     1: 2   Acyl-CoA dehydrogenase, short-chain specific (EC 1.3.99.2) locus|SA0169, protein_id|NP_373412.1, gi|15925879, geneID|1122945
179 193652 193912 261 + 315         FIG01108230: hypothetical protein locus|SA0170, protein_id|NP_373413.1, gi|15925880, geneID|1122946
180 193987 195111 1125 + 74     2: 5 4   NAD-dependent formate dehydrogenase (EC 1.17.1.9) gene_name|fdh, locus|SA0171, protein_id|NP_373414.1, gi|15925881, geneID|1122947

Annotation History   /   View All Related Annotations Help on Annotations


  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|158879.11.peg.174 FIG01108032: hypothetical protein
MTLFLLEANNLDFASTKEELEAKAASLSTKTIPTLIEVQATENLTHGYFIVEANDEAEAK
QFLTEADISIQLVKEVRLVGKDLDEVKNGDAHVDYLVTWNIPEGITMDQYLARKKKNSVH
YEEVPEVEFKRTYVCEDMSKCICLYNAPDEEAVRRARKAVDTPIDGIEKL

MD5 = af7889710688af5f0d02177beb1192f4


  DNA Sequence

>fig|158879.11.peg.174 FIG01108032: hypothetical protein
atgacattatttttattagaagctaacaatcttgattttgcatcaacgaaagaagaacta
gaagcaaaggcagcatcactatctacgaagacaattccaacattaattgaagtacaagct
actgaaaatttaactcatggttattttattgtggaagcaaatgacgaagcagaagctaaa
caatttttaacagaagcagatattagtattcaattagtcaaagaagtacgcttagttggt
aaagatttagatgaagttaaaaatggtgatgcacatgttgattaccttgtaacttggaac
attccggaaggcattacgatggatcaatatttagcacgtaaaaagaaaaattctgttcat
tatgaagaagtgccagaagttgaatttaaacgcacatatgtatgtgaagatatgtctaaa
tgtatttgtttatacaacgcacctgatgaagaagcggtacgtcgcgcgcgaaaagcagtt
gatacaccgattgatggcatcgaaaaactttaa


  DNA with Flanking Sequence

>fig|158879.11.peg.174 FIG01108032: hypothetical protein
ggccccaacaaagagaaattggattcccaatttctacagacaatgcaagttggggtggga
caacgaaataaattttgcgaaaatatcatttctgtcccactcccacgtttgttttggatt
atgttgcatcatttaaatgattttcgtcaatttctttgatgctatctacatctaacacga
catctttaggtttcaaaatatgaatatgtttttcatcatttgtatgtaaaatgcgttcta
tgatgtatctttgaccggccattgtttctacagcaatctttttgtttctagctaaacttg
ctacgacagattctttatccataatgatagccccctatatatatgtttatttacttatac
cctaacatgatttttatactctttgaaaatatattttacagaattttatctaaatattta
aaaaaatcgctcaatatccttgtaatccgataagaattatagtaatattttttcaaccat
tgttataggaggtcttattaatgacattatttttattagaagctaacaatcttgattttg
catcaacgaaagaagaactagaagcaaaggcagcatcactatctacgaagacaattccaa
cattaattgaagtacaagctactgaaaatttaactcatggttattttattgtggaagcaa
atgacgaagcagaagctaaacaatttttaacagaagcagatattagtattcaattagtca
aagaagtacgcttagttggtaaagatttagatgaagttaaaaatggtgatgcacatgttg
attaccttgtaacttggaacattccggaaggcattacgatggatcaatatttagcacgta
aaaagaaaaattctgttcattatgaagaagtgccagaagttgaatttaaacgcacatatg
tatgtgaagatatgtctaaatgtatttgtttatacaacgcacctgatgaagaagcggtac
gtcgcgcgcgaaaagcagttgatacaccgattgatggcatcgaaaaactttaataagaca
acaagttgatgagatatatgtatataggtttgacgtggatttcgattgcagttaattaga
atagctcaatgctataaatgtaagtagttgatatgaagaaactaatgaactaaatgcaag
tattttctaaaacaatcattttattgaaatttagtagagctgaaattaatataacgtcgt
taattgaataacgcttatgttataagagcactcataccaaaccataatcatctatagata
taacaattcacgatataagggctgtgtttggcatagccctttagatatacacttaattcc
tattaaaatagtagggattaaaagggggcttgtcatgattaaaattcaacaattacaaca
tcactttggatcacataaagtaattcataactttaatttggacattagcaagggagaaat
agtcactttcatagggaaaagtggttgcggaaagtctactttactcaatgttatcggtgg
atttattcatcca


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
cmr|NT01SA0175 Staphylococcus aureus N315     conserved hypothetical protein
cmr|NT02SA0167 Staphylococcus aureus Mu50     SrpF
cmr|NT03SA0160 Staphylococcus aureus MW2     conserved hypothetical protein
cmr|NT05SA0122 Staphylococcus aureus NCTC 8325     pANL51
cmr|NT09SA0144 Staphylococcus aureus subsp. aureus MSSA476     SrpF
cmr|SACOL0157 Staphylococcus aureus subsp. aureus COL     conserved hypothetical protein
cmr|SAUSA300_0173 Staphylococcus aureus subsp. aureus USA300-FPR3757     conserved hypothetical protein
dbj|BAB41386.1 Staphylococcus aureus subsp. aureus N315     SA0165
dbj|BAB56333.1 Staphylococcus aureus subsp. aureus Mu50     hypothetical protein
dbj|BAB94010.1 Staphylococcus aureus subsp. aureus MW2     MW0145
dbj|BAF66387.1 Staphylococcus aureus subsp. aureus str. Newman     conserved hypothetical protein
dbj|BAF77053.1 Staphylococcus aureus subsp. aureus Mu3     hypothetical protein
emb|CAG41914.1 Staphylococcus aureus subsp. aureus MSSA476 EMBL   conserved hypothetical protein
fig|158878.1.peg.171 Staphylococcus aureus subsp. aureus Mu50 FIG   FIG01108032: hypothetical protein
fig|158878.14.peg.172 Staphylococcus aureus subsp. aureus Mu50 FIG   FIG01108032: hypothetical protein
fig|158879.1.peg.169 Staphylococcus aureus subsp. aureus N315 FIG   FIG01108032: hypothetical protein
fig|196620.1.peg.145 Staphylococcus aureus subsp. aureus MW2 FIG   FIG01108032: hypothetical protein
fig|196620.5.peg.161 Staphylococcus aureus subsp. aureus MW2 FIG   FIG01108032: hypothetical protein
fig|282459.1.peg.135 Staphylococcus aureus subsp. aureus MSSA476 FIG   FIG01108032: hypothetical protein
fig|282459.5.peg.157 Staphylococcus aureus subsp. aureus MSSA476 FIG   FIG01108032: hypothetical protein
fig|359786.13.peg.199 Staphylococcus aureus subsp. aureus JH9 FIG   FIG01108032: hypothetical protein
fig|359786.3.peg.1123 Staphylococcus aureus subsp. aureus JH9 FIG   FIG01108032: hypothetical protein
fig|359787.11.peg.196 Staphylococcus aureus subsp. aureus JH1 FIG   FIG01108032: hypothetical protein
fig|359787.3.peg.1982 Staphylococcus aureus subsp. aureus JH1 FIG   FIG01108032: hypothetical protein
fig|367830.3.peg.1463 Staphylococcus aureus subsp. aureus USA300 FIG   FIG01108032: hypothetical protein
fig|418127.4.peg.152 Staphylococcus aureus subsp. aureus Mu3 FIG   FIG01108032: hypothetical protein
fig|418127.6.peg.171 Staphylococcus aureus subsp. aureus Mu3 FIG   FIG01108032: hypothetical protein
fig|426430.6.peg.116 Staphylococcus aureus subsp. aureus str. Newman FIG   FIG01108032: hypothetical protein
fig|426430.8.peg.125 Staphylococcus aureus subsp. aureus str. Newman FIG   FIG01108032: hypothetical protein
fig|450394.6.peg.1930 Staphylococcus aureus subsp. aureus USA300_TCH959 FIG   FIG01108032: hypothetical protein
fig|451515.3.peg.232 Staphylococcus aureus subsp. aureus USA300_FPR3757 FIG   FIG01108032: hypothetical protein
fig|451516.9.peg.221 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   FIG01108032: hypothetical protein
fig|452948.4.peg.23 Staphylococcus aureus 930918-3 FIG   FIG01108032: hypothetical protein
fig|455227.3.peg.186 Staphylococcus aureus D30 FIG   FIG01108032: hypothetical protein
fig|505321.3.peg.1925 Staphylococcus aureus subsp. aureus str. CF-Marseille FIG   FIG01108032: hypothetical protein
fig|548474.3.peg.2245 Staphylococcus aureus subsp. aureus TCH130 FIG   FIG01108032: hypothetical protein
fig|548475.3.peg.2247 Staphylococcus aureus subsp. aureus TCH70 FIG   FIG01108032: hypothetical protein
fig|553565.3.peg.2490 Staphylococcus aureus A5937 FIG   FIG01108032: hypothetical protein
fig|553567.3.peg.1097 Staphylococcus aureus A5948 FIG   FIG01108032: hypothetical protein
fig|553568.3.peg.805 Staphylococcus aureus A6224 FIG   FIG01108032: hypothetical protein
fig|553571.3.peg.2074 Staphylococcus aureus A6300 FIG   FIG01108032: hypothetical protein
fig|553573.3.peg.1967 Staphylococcus aureus A8115 FIG   FIG01108032: hypothetical protein
fig|553574.3.peg.676 Staphylococcus aureus A8117 FIG   FIG01108032: hypothetical protein
fig|553577.3.peg.845 Staphylococcus aureus A8796 FIG   FIG01108032: hypothetical protein
fig|553580.3.peg.581 Staphylococcus aureus A8819 FIG   FIG01108032: hypothetical protein
fig|553581.3.peg.2099 Staphylococcus aureus A9299 FIG   FIG01108032: hypothetical protein
fig|553588.3.peg.1484 Staphylococcus aureus A9719 FIG   FIG01108032: hypothetical protein
fig|553590.4.peg.1175 Staphylococcus aureus A9754 FIG   FIG01108032: hypothetical protein
fig|553592.3.peg.861 Staphylococcus aureus A9763 FIG   FIG01108032: hypothetical protein
fig|553594.3.peg.834 Staphylococcus aureus A9765 FIG   FIG01108032: hypothetical protein
fig|553596.3.peg.888 Staphylococcus aureus A9781 FIG   FIG01108032: hypothetical protein
fig|553601.3.peg.35 Staphylococcus aureus A10102 FIG   FIG01108032: hypothetical protein
fig|585891.3.peg.172 Staphylococcus aureus subsp. aureus Mu50-omega FIG   FIG01108032: hypothetical protein
fig|644279.4.peg.242 Staphylococcus aureus subsp. aureus 132 FIG   FIG01108032: hypothetical protein
fig|680649.3.peg.1579 Staphylococcus aureus subsp. aureus MR1 FIG   FIG01108032: hypothetical protein
fig|681288.4.peg.141 Staphylococcus aureus subsp. aureus ED98 FIG   FIG01108032: hypothetical protein
fig|703339.3.peg.174 Staphylococcus aureus 04-02981 FIG   FIG01108032: hypothetical protein
fig|762962.3.peg.1655 Staphylococcus aureus subsp. aureus ATCC 51811 FIG   FIG01108032: hypothetical protein
fig|93061.3.peg.148 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   FIG01108032: hypothetical protein
fig|93061.5.peg.127 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   FIG01108032: hypothetical protein
fig|93062.19.peg.155 Staphylococcus aureus subsp. aureus COL FIG   FIG01108032: hypothetical protein
fig|93062.4.peg.624 Staphylococcus aureus subsp. aureus COL FIG   FIG01108032: hypothetical protein
gb|AAW37454.1 Staphylococcus aureus subsp. aureus COL     conserved hypothetical protein
gb|ABD22405.1 Staphylococcus aureus subsp. aureus USA300_FPR3757     conserved hypothetical protein
gb|ABD29316.1 Staphylococcus aureus subsp. aureus NCTC 8325     conserved hypothetical protein
gb|ABQ47963.1 Staphylococcus aureus subsp. aureus JH9     hypothetical protein SaurJH9_0156
gb|ABR51023.1 Staphylococcus aureus subsp. aureus JH1     conserved hypothetical protein
gb|ABX28216.1 Staphylococcus aureus subsp. aureus USA300_TCH1516     hypothetical protein USA300HOU_0184
gb|EES56551.1 Staphylococcus aureus subsp. aureus TCH70     conserved hypothetical protein
gb|EES94393.1 Staphylococcus aureus subsp. aureus USA300_TCH959     conserved hypothetical protein
gb|EES95941.1 Staphylococcus aureus subsp. aureus TCH130     conserved hypothetical protein
gb|EEV26327.1 Staphylococcus aureus A9781     conserved hypothetical protein
gb|EEV65045.1 Staphylococcus aureus A9763     conserved hypothetical protein
gb|EEV67013.1 Staphylococcus aureus A9719     conserved hypothetical protein
gb|EEV71789.1 Staphylococcus aureus A9299     conserved hypothetical protein
gb|EEV74359.1 Staphylococcus aureus A8115     conserved hypothetical protein
gb|EEV76997.1 Staphylococcus aureus A6300     conserved hypothetical protein
gb|EEV81008.1 Staphylococcus aureus A6224     conserved hypothetical protein
gb|EEV83478.1 Staphylococcus aureus A5948     conserved hypothetical protein
gb|EEV84707.1 Staphylococcus aureus A5937     conserved hypothetical protein
gb|EEW45984.1 Staphylococcus aureus 930918-3     hypothetical protein SA930_0643
gb|EEW48129.1 Staphylococcus aureus D30     hypothetical protein SAD30_1684
gi|13700087 Staphylococcus aureus subsp. aureus N315 NCBI   SA0165
gi|14245938 Staphylococcus aureus subsp. aureus Mu50 NCBI   hypothetical protein
gi|147739665 Staphylococcus aureus subsp. aureus JH9 NCBI   hypothetical protein SaurJH9_0156
gi|148266596 Staphylococcus aureus subsp. aureus JH9 NCBI   hypothetical protein SaurJH9_0156
gi|149945087 Staphylococcus aureus subsp. aureus JH1 NCBI   conserved hypothetical protein
gi|150373127 Staphylococcus aureus subsp. aureus str. Newman NCBI   conserved hypothetical protein
gi|150392635 Staphylococcus aureus subsp. aureus JH1 NCBI   hypothetical protein SaurJH1_0161
gi|151220327 Staphylococcus aureus subsp. aureus str. Newman NCBI   hypothetical protein NWMN_0115
gi|156720636 Staphylococcus aureus subsp. aureus Mu3 NCBI   hypothetical protein
gi|156978501 Staphylococcus aureus subsp. aureus Mu3 NCBI   hypothetical protein SAHV_0170
gi|15923161 Staphylococcus aureus subsp. aureus Mu50 NCBI   hypothetical protein SAV0171
gi|15925875 Staphylococcus aureus subsp. aureus N315 NCBI   hypothetical protein SA0165
gi|160367245 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   hypothetical protein USA300HOU_0184
gi|161508436 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   hypothetical protein USA300HOU_0184
gi|21203309 Staphylococcus aureus subsp. aureus MW2 NCBI   MW0145
gi|21281874 Staphylococcus aureus subsp. aureus MW2 NCBI   hypothetical protein MW0145
gi|251803894 Staphylococcus aureus subsp. aureus TCH70 NCBI   conserved hypothetical protein
gi|251812673 Staphylococcus aureus subsp. aureus TCH70 NCBI   conserved hypothetical protein
gi|253316393 Staphylococcus aureus subsp. aureus str. CF-Marseille NCBI   hypothetical protein SauraC_09666
gi|253725664 Staphylococcus aureus subsp. aureus USA300_TCH959 NCBI   conserved hypothetical protein
gi|253727212 Staphylococcus aureus subsp. aureus TCH130 NCBI   conserved hypothetical protein
gi|253730524 Staphylococcus aureus subsp. aureus USA300_TCH959 NCBI   conserved hypothetical protein
gi|253734733 Staphylococcus aureus subsp. aureus TCH130 NCBI   conserved hypothetical protein
gi|255004967 Staphylococcus aureus subsp. aureus Mu50-omega NCBI   hypothetical protein SauraM_00820
gi|257787987 Staphylococcus aureus A9781 NCBI   conserved hypothetical protein
gi|257794015 Staphylococcus aureus A9781 NCBI   conserved hypothetical protein
gi|257840586 Staphylococcus aureus A9763 NCBI   conserved hypothetical protein
gi|257842591 Staphylococcus aureus A9719 NCBI   conserved hypothetical protein
gi|257847793 Staphylococcus aureus A9299 NCBI   conserved hypothetical protein
gi|257850411 Staphylococcus aureus A8115 NCBI   conserved hypothetical protein
gi|257854044 Staphylococcus aureus A6300 NCBI   conserved hypothetical protein
gi|257858120 Staphylococcus aureus A6224 NCBI   conserved hypothetical protein
gi|257860656 Staphylococcus aureus A5948 NCBI   conserved hypothetical protein
gi|257861934 Staphylococcus aureus A5937 NCBI   conserved hypothetical protein
gi|258408577 Staphylococcus aureus A9763 NCBI   conserved hypothetical protein
gi|258421167 Staphylococcus aureus A9719 NCBI   conserved hypothetical protein
gi|258438917 Staphylococcus aureus A9299 NCBI   conserved hypothetical protein
gi|258444152 Staphylococcus aureus A8115 NCBI   conserved hypothetical protein
gi|258447031 Staphylococcus aureus A6300 NCBI   conserved hypothetical protein
gi|258448489 Staphylococcus aureus A6224 NCBI   conserved hypothetical protein
gi|258451608 Staphylococcus aureus A5948 NCBI   conserved hypothetical protein
gi|258455722 Staphylococcus aureus A5937 NCBI   conserved hypothetical protein
gi|259160965 Staphylococcus aureus 930918-3 NCBI   hypothetical protein SA930_0643
gi|259163573 Staphylococcus aureus D30 NCBI   hypothetical protein SAD30_1684
gi|49243490 Staphylococcus aureus subsp. aureus MSSA476 NCBI   conserved hypothetical protein
gi|49485047 Staphylococcus aureus subsp. aureus MSSA476 NCBI   hypothetical protein SAS0146
gi|57285360 Staphylococcus aureus subsp. aureus COL NCBI   conserved hypothetical protein
gi|57651174 Staphylococcus aureus subsp. aureus COL NCBI   hypothetical protein SACOL0157
gi|87127891 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   conserved hypothetical protein
gi|87161917 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   hypothetical protein SAUSA300_0173
gi|87201506 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   conserved hypothetical protein
gi|88193948 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   hypothetical protein SAOUHSC_00135
img|637091766 Staphylococcus aureus aureus N315 IMG   hypothetical protein
img|637098670 Staphylococcus aureus aureus Mu50 IMG   hypothetical protein
img|637150940 Staphylococcus aureus aureus COL IMG   hypothetical protein
img|637156348 Staphylococcus aureus aureus MSSA476 IMG   hypothetical protein
img|637297885 Staphylococcus aureus aureus MW2 IMG   hypothetical protein
img|637886828 Staphylococcus aureus aureus USA300 IMG   hypothetical protein
img|637892809 Staphylococcus aureus aureus NCTC 8325 IMG   hypothetical protein
img|639108484 Staphylococcus aureus aureus JH1 IMG   conserved hypothetical protein
img|640564486 Staphylococcus aureus aureus JH9 IMG   hypothetical protein
img|640778231 Staphylococcus aureus aureus JH1 IMG   hypothetical protein
img|640794475 Staphylococcus aureus aureus Newman IMG   hypothetical protein
img|640902892 Staphylococcus aureus aureus Mu3 IMG   hypothetical protein
img|641308144 Staphylococcus aureus subsp. aureus USA300_TCH1516 IMG   hypothetical protein
img|641771890 Staphylococcus aureus aureus USA300_TCH959 IMG   hypothetical protein
kegg|saa:SAUSA300_0173 Staphylococcus aureus subsp. aureus USA300_FPR3757 KEGG   hypothetical protein
kegg|sac:SACOL0157 Staphylococcus aureus subsp. aureus COL KEGG   hypothetical protein
kegg|sae:NWMN_0115 Staphylococcus aureus subsp. aureus Newman KEGG   hypothetical protein
kegg|sah:SaurJH1_0161 Staphylococcus aureus subsp. aureus JH1 KEGG   hypothetical protein
kegg|saj:SaurJH9_0156 Staphylococcus aureus subsp. aureus JH9 KEGG   hypothetical protein
kegg|sam:MW0145 Staphylococcus aureus subsp. aureus MW2 KEGG   hypothetical protein
kegg|sao:SAOUHSC_00135 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   hypothetical protein
kegg|sas:SAS0146   KEGG   hypothetical protein
kegg|sau:SA0165   KEGG   hypothetical protein
kegg|sav:SAV0171   KEGG   hypothetical protein
kegg|saw:SAHV_0170 Staphylococcus aureus subsp. aureus Mu3 KEGG   hypothetical protein
kegg|sax:USA300HOU_0184 Staphylococcus aureus subsp. aureus USA300_TCH1516 KEGG   hypothetical protein
ref|NP_370695.1 Staphylococcus aureus subsp. aureus Mu50 RefSeq   hypothetical protein SAV0171
ref|NP_373408.1 Staphylococcus aureus subsp. aureus N315 RefSeq   hypothetical protein SA0165
ref|NP_644960.1 Staphylococcus aureus subsp. aureus MW2 RefSeq   hypothetical protein MW0145
ref|YP_001245539.1 Staphylococcus aureus subsp. aureus JH9 RefSeq   hypothetical protein SaurJH9_0156
ref|YP_001315310.1 Staphylococcus aureus subsp. aureus JH1 RefSeq   hypothetical protein SaurJH1_0161
ref|YP_001331150.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   hypothetical protein NWMN_0115
ref|YP_001440760.1 Staphylococcus aureus subsp. aureus Mu3 RefSeq   hypothetical protein SAHV_0170
ref|YP_001574095.1 Staphylococcus aureus subsp. aureus USA300_TCH1516 RefSeq   hypothetical protein USA300HOU_0184
ref|YP_042268.1 Staphylococcus aureus subsp. aureus MSSA476 RefSeq   hypothetical protein SAS0146
ref|YP_185057.1 Staphylococcus aureus subsp. aureus COL RefSeq   hypothetical protein SACOL0157
ref|YP_492887.1 Staphylococcus aureus subsp. aureus USA300_FPR3757 RefSeq   hypothetical protein SAUSA300_0173
ref|YP_498735.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   hypothetical protein SAOUHSC_00135
ref|ZP_04827146.1 Staphylococcus aureus subsp. aureus TCH70 RefSeq   conserved hypothetical protein
ref|ZP_04839606.1 Staphylococcus aureus subsp. aureus str. CF-Marseille RefSeq   hypothetical protein SauraC_09666
ref|ZP_04864689.1 Staphylococcus aureus subsp. aureus USA300_TCH959 RefSeq   conserved hypothetical protein
ref|ZP_04868898.1 Staphylococcus aureus subsp. aureus TCH130 RefSeq   conserved hypothetical protein
ref|ZP_05143568.2 Staphylococcus aureus subsp. aureus Mu50-omega RefSeq   hypothetical protein SauraM_00820
ref|ZP_05642994.1 Staphylococcus aureus A9781 RefSeq   conserved hypothetical protein
ref|ZP_05680862.1 Staphylococcus aureus A9763 RefSeq   conserved hypothetical protein
ref|ZP_05684094.1 Staphylococcus aureus A9719 RefSeq   conserved hypothetical protein
ref|ZP_05690008.1 Staphylococcus aureus A9299 RefSeq   conserved hypothetical protein
ref|ZP_05692486.1 Staphylococcus aureus A8115 RefSeq   conserved hypothetical protein
ref|ZP_05695181.1 Staphylococcus aureus A6300 RefSeq   conserved hypothetical protein
ref|ZP_05696602.1 Staphylococcus aureus A6224 RefSeq   conserved hypothetical protein
ref|ZP_05699634.1 Staphylococcus aureus A5948 RefSeq   conserved hypothetical protein
ref|ZP_05703677.1 Staphylococcus aureus A5937 RefSeq   conserved hypothetical protein
tr|A5IP40 Staphylococcus aureus (strain JH9) TrEMBL   Putative uncharacterized protein
tr|A6QDF5 Staphylococcus aureus (strain Newman) TrEMBL   Putative uncharacterized protein
tr|A6TXV5 Staphylococcus aureus (strain JH1) TrEMBL   Putative uncharacterized protein
tr|A7WXF6 Staphylococcus aureus (strain Mu3 / ATCC 700698) TrEMBL   Putative uncharacterized protein
tr|A8YZ93 Staphylococcus aureus (strain USA300 / TCH1516) TrEMBL   Putative uncharacterized protein
tr|C5N147 Staphylococcus aureus subsp. aureus USA300_TCH959 TrEMBL   Putative uncharacterized protein
tr|C5Q429 Staphylococcus aureus subsp. aureus TCH130 TrEMBL   Putative uncharacterized protein
tr|C5QE45 Staphylococcus aureus subsp. aureus TCH70 TrEMBL   Putative uncharacterized protein
tr|Q2FK91 Staphylococcus aureus (strain USA300) TrEMBL   Putative uncharacterized protein
tr|Q2G1I7 Staphylococcus aureus (strain NCTC 8325) TrEMBL   Putative uncharacterized protein
tr|Q5HJK0 Staphylococcus aureus (strain COL) TrEMBL   Putative uncharacterized protein
tr|Q6GCV5 Staphylococcus aureus (strain MSSA476) TrEMBL   Putative uncharacterized protein
tr|Q7A1Y5 Staphylococcus aureus (strain MW2) TrEMBL   MW0145 protein
tr|Q7A821 Staphylococcus aureus (strain N315) TrEMBL   SA0165 protein
tr|Q99X50 Staphylococcus aureus (strain Mu50 / ATCC 700699) TrEMBL   Putative uncharacterized protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link

  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key		 Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer

Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options

|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions
FIG search