The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|158879.11.peg.173: Staphylococcus aureus subsp. aureus N315

This feature in The SEED Viewer

NCBI Taxonomy Id: 158879

Current Assignment: FIG01108246: hypothetical protein
Translate Function Assignments



Context on contig NC_002745 from base 182832 to 193912 (11081 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
164 182832 183977 1146 +           Capsular polysaccharide synthesis enzyme Cap8P gene_name|capP, locus|SA0159, protein_id|NP_373401.1, gi|15925868, geneID|1122934
165 184368 184042 327 - 64     1: 1 dlit(14570922)
dlit(15520015)
Heme-degrading monooxygenase, staphylobilin-producing (EC 1.14.99.48) # IsdI locus|SA0160, protein_id|NP_373402.1, gi|15925869, geneID|1122935
166 184758 184375 384 - 6     1: 1   Inner membrane protein YbaN locus|SA0161, protein_id|NP_373403.1, gi|15925870, geneID|1122936
167 185185 186672 1488 + 426     3: 4 6 7   Aldehyde dehydrogenase B (EC 1.2.1.22) gene_name|aldA, locus|SA0162, protein_id|NP_373404.1, gi|15925871, geneID|1122937
168 187319 188278 960 + 646     3: 3 8 5   Cobalt-zinc-cadmium resistance protein locus|SA0163, protein_id|NP_373405.1, gi|15925872, geneID|1122938
169 188407 188270 138 - -9         hypothetical protein  
170 188346 188525 180 + -62         hypothetical protein  
171 188543 188388 156 - -138         hypothetical protein locus|SAS005, protein_id|NP_373406.1, gi|15925873, geneID|1122939
172 188438 188590 153 + -106         hypothetical protein  
173 188776 188573 204 - -18         FIG01108246: hypothetical protein locus|SA0164, protein_id|NP_373407.1, gi|15925874, geneID|1122940
174 188955 189467 513 + 178         FIG01108032: hypothetical protein locus|SA0165, protein_id|NP_373408.1, gi|15925875, geneID|1122941
175 189809 190549 741 + 341         ABC transporter, ATP-binding protein locus|SA0166, protein_id|NP_373409.1, gi|15925876, geneID|1122942
176 190563 191534 972 + 13         FIG01108009: hypothetical protein locus|SA0167, protein_id|NP_373410.1, gi|15925877, geneID|1122943
177 191531 192292 762 + -4         ABC transporter, permease protein (cluster 10, nitrate/sulfonate/bicarbonate) locus|SA0168, protein_id|NP_373411.1, gi|15925878, geneID|1122944
178 192302 193336 1035 + 9     1: 2   Acyl-CoA dehydrogenase, short-chain specific (EC 1.3.99.2) locus|SA0169, protein_id|NP_373412.1, gi|15925879, geneID|1122945
179 193652 193912 261 + 315         FIG01108230: hypothetical protein locus|SA0170, protein_id|NP_373413.1, gi|15925880, geneID|1122946

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|158879.11.peg.173 FIG01108246: hypothetical protein
MDKESVVASLARNKKIAVETMAGQRYIIERILHTNDEKHIHILKPKDVVLDVDSIKEIDE
NHLNDAT

MD5 = 2d58668e2cd334d0a9e301e4c7e5f9c8


  DNA Sequence

>fig|158879.11.peg.173 FIG01108246: hypothetical protein
atggataaagaatctgtcgtagcaagtttagctagaaacaaaaagattgctgtagaaaca
atggccggtcaaagatacatcatagaacgcattttacatacaaatgatgaaaaacatatt
catattttgaaacctaaagatgtcgtgttagatgtagatagcatcaaagaaattgacgaa
aatcatttaaatgatgcaacataa


  DNA with Flanking Sequence

>fig|158879.11.peg.173 FIG01108246: hypothetical protein
ccatcgtaatgccttccggaatgttccaagttacaaggtaatcaacatgtgcatcaccat
ttttaacttcatctaaatctttaccaactaagcgtacttctttgactaattgaatactaa
tatctgcttctgttaaaaattgtttagcttctgcttcgtcatttgcttccacaataaaat
aaccatgagttaaattttcagtagcttgtacttcaattaatgttggaattgtcttcgtag
atagtgatgctgcctttgcttctagttcttctttcgttgatgcaaaatcaagattgttag
cttctaataaaaataatgtcattaataagacctcctataacaatggttgaaaaaatatta
ctataattcttatcggattacaaggatattgagcgatttttttaaatatttagataaaat
tctgtaaaatatattttcaaagagtataaaaatcatgttagggtataagtaaataaacat
atatatagggggctatcattatggataaagaatctgtcgtagcaagtttagctagaaaca
aaaagattgctgtagaaacaatggccggtcaaagatacatcatagaacgcattttacata
caaatgatgaaaaacatattcatattttgaaacctaaagatgtcgtgttagatgtagata
gcatcaaagaaattgacgaaaatcatttaaatgatgcaacataatccaaaacaaacgtgg
gagtgggacagaaatgatattttcgcaaaatttatttcgttgtcccaccccaacttgcat
tgtctgtagaaattgggaatccaatttctctttgttggggcccacaccccaacttgcatt
gcctgtagaatttcttttcgaaattctctgtgttggggcccctgactagaattgaaaaaa
gcttgttacaagcgcattttcgttcagtcaactactgccaatataacttcgtagagcata
gaacattgatttatgtcccagcctgtacaatgttttatttatgttaatttgtcgaagtat
ggctcatctaatggattcaattgcaagttttcaatttgcaacgttgaatgtgcaatgcca
tatttttctttcaacaatgatgatacttgatcaatcgcttgataatcatcaccctcatat
tttttatctaacacaacatgggcacttaatgaataatgctctgttgtaatactccacaaa
tgaa


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
cmr|NT01SA0174 Staphylococcus aureus N315     lacitehtopyh-related protein
cmr|NT02SA0166 Staphylococcus aureus Mu50     conserved hypothetical protein
cmr|NT03SA0159 Staphylococcus aureus MW2     conserved hypothetical protein
cmr|NT05SA0121 Staphylococcus aureus NCTC 8325     conserved hypothetical protein
cmr|NT09SA0143 Staphylococcus aureus subsp. aureus MSSA476     conserved hypothetical protein
cmr|NT11SA0117 Staphylococcus aureus RF122     conserved hypothetical protein
cmr|SACOL0156 Staphylococcus aureus subsp. aureus COL     hypothetical protein
cmr|SAUSA300_0172 Staphylococcus aureus subsp. aureus USA300-FPR3757     conserved hypothetical protein
dbj|BAB41385.1 Staphylococcus aureus subsp. aureus N315     hypothetical protein
dbj|BAB56332.1 Staphylococcus aureus subsp. aureus Mu50     hypothetical protein
dbj|BAB94009.1 Staphylococcus aureus subsp. aureus MW2     hypothetical protein
dbj|BAF77052.1 Staphylococcus aureus subsp. aureus Mu3     hypothetical protein
emb|CAG41913.1 Staphylococcus aureus subsp. aureus MSSA476 EMBL   hypothetical protein
emb|CAI79798.1 Staphylococcus aureus RF122 EMBL   hypothetical protein
fig|158878.1.peg.170 Staphylococcus aureus subsp. aureus Mu50 FIG   FIG01108246: hypothetical protein
fig|158878.14.peg.171 Staphylococcus aureus subsp. aureus Mu50 FIG   FIG01108246: hypothetical protein
fig|158879.1.peg.168 Staphylococcus aureus subsp. aureus N315 FIG   FIG01108246: hypothetical protein
fig|196620.1.peg.144 Staphylococcus aureus subsp. aureus MW2 FIG   FIG01108246: hypothetical protein
fig|196620.5.peg.160 Staphylococcus aureus subsp. aureus MW2 FIG   FIG01108246: hypothetical protein
fig|273036.3.peg.228 Staphylococcus aureus RF122 FIG   FIG01108246: hypothetical protein
fig|273036.6.peg.125 Staphylococcus aureus RF122 FIG   FIG01108246: hypothetical protein
fig|282459.1.peg.134 Staphylococcus aureus subsp. aureus MSSA476 FIG   FIG01108246: hypothetical protein
fig|282459.5.peg.156 Staphylococcus aureus subsp. aureus MSSA476 FIG   FIG01108246: hypothetical protein
fig|359786.13.peg.198 Staphylococcus aureus subsp. aureus JH9 FIG   FIG01108246: hypothetical protein
fig|359786.3.peg.1124 Staphylococcus aureus subsp. aureus JH9 FIG   FIG01108246: hypothetical protein
fig|359787.11.peg.195 Staphylococcus aureus subsp. aureus JH1 FIG   FIG01108246: hypothetical protein
fig|359787.3.peg.2003 Staphylococcus aureus subsp. aureus JH1 FIG   FIG01108246: hypothetical protein
fig|367830.3.peg.1462 Staphylococcus aureus subsp. aureus USA300 FIG   FIG01108246: hypothetical protein
fig|418127.4.peg.151 Staphylococcus aureus subsp. aureus Mu3 FIG   FIG01108246: hypothetical protein
fig|418127.6.peg.170 Staphylococcus aureus subsp. aureus Mu3 FIG   FIG01108246: hypothetical protein
fig|426430.6.peg.115 Staphylococcus aureus subsp. aureus str. Newman FIG   FIG01108246: hypothetical protein
fig|426430.8.peg.124 Staphylococcus aureus subsp. aureus str. Newman FIG   FIG01108246: hypothetical protein
fig|450394.6.peg.1929 Staphylococcus aureus subsp. aureus USA300_TCH959 FIG   FIG01108246: hypothetical protein
fig|451515.3.peg.231 Staphylococcus aureus subsp. aureus USA300_FPR3757 FIG   FIG01108246: hypothetical protein
fig|451516.9.peg.220 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   FIG01108246: hypothetical protein
fig|452948.4.peg.22 Staphylococcus aureus 930918-3 FIG   FIG01108246: hypothetical protein
fig|455227.3.peg.185 Staphylococcus aureus D30 FIG   FIG01108246: hypothetical protein
fig|505321.3.peg.1926 Staphylococcus aureus subsp. aureus str. CF-Marseille FIG   FIG01108246: hypothetical protein
fig|548474.3.peg.2244 Staphylococcus aureus subsp. aureus TCH130 FIG   FIG01108246: hypothetical protein
fig|548475.3.peg.2248 Staphylococcus aureus subsp. aureus TCH70 FIG   FIG01108246: hypothetical protein
fig|553565.3.peg.2489 Staphylococcus aureus A5937 FIG   FIG01108246: hypothetical protein
fig|553567.3.peg.1096 Staphylococcus aureus A5948 FIG   FIG01108246: hypothetical protein
fig|553568.3.peg.804 Staphylococcus aureus A6224 FIG   FIG01108246: hypothetical protein
fig|553571.3.peg.2073 Staphylococcus aureus A6300 FIG   FIG01108246: hypothetical protein
fig|553573.3.peg.1966 Staphylococcus aureus A8115 FIG   FIG01108246: hypothetical protein
fig|553574.3.peg.675 Staphylococcus aureus A8117 FIG   FIG01108246: hypothetical protein
fig|553577.3.peg.844 Staphylococcus aureus A8796 FIG   FIG01108246: hypothetical protein
fig|553580.3.peg.580 Staphylococcus aureus A8819 FIG   FIG01108246: hypothetical protein
fig|553581.3.peg.2098 Staphylococcus aureus A9299 FIG   FIG01108246: hypothetical protein
fig|553588.3.peg.1483 Staphylococcus aureus A9719 FIG   FIG01108246: hypothetical protein
fig|553590.4.peg.1174 Staphylococcus aureus A9754 FIG   FIG01108246: hypothetical protein
fig|553592.3.peg.860 Staphylococcus aureus A9763 FIG   FIG01108246: hypothetical protein
fig|553594.3.peg.833 Staphylococcus aureus A9765 FIG   FIG01108246: hypothetical protein
fig|553596.3.peg.889 Staphylococcus aureus A9781 FIG   FIG01108246: hypothetical protein
fig|553601.3.peg.34 Staphylococcus aureus A10102 FIG   FIG01108246: hypothetical protein
fig|585891.3.peg.171 Staphylococcus aureus subsp. aureus Mu50-omega FIG   FIG01108246: hypothetical protein
fig|644279.4.peg.241 Staphylococcus aureus subsp. aureus 132 FIG   FIG01108246: hypothetical protein
fig|680649.3.peg.1580 Staphylococcus aureus subsp. aureus MR1 FIG   FIG01108246: hypothetical protein
fig|681288.4.peg.140 Staphylococcus aureus subsp. aureus ED98 FIG   FIG01108246: hypothetical protein
fig|703339.3.peg.173 Staphylococcus aureus 04-02981 FIG   FIG01108246: hypothetical protein
fig|762962.3.peg.1656 Staphylococcus aureus subsp. aureus ATCC 51811 FIG   FIG01108246: hypothetical protein
fig|93061.3.peg.147 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   FIG01108246: hypothetical protein
fig|93061.5.peg.126 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   FIG01108246: hypothetical protein
fig|93062.19.peg.154 Staphylococcus aureus subsp. aureus COL FIG   FIG01108246: hypothetical protein
fig|93062.4.peg.623 Staphylococcus aureus subsp. aureus COL FIG   FIG01108246: hypothetical protein
gb|AAW37453.1 Staphylococcus aureus subsp. aureus COL     hypothetical protein SACOL0156
gb|ABD20909.1 Staphylococcus aureus subsp. aureus USA300_FPR3757     conserved hypothetical protein
gb|ABD29315.1 Staphylococcus aureus subsp. aureus NCTC 8325     conserved hypothetical protein
gb|ABQ47962.1 Staphylococcus aureus subsp. aureus JH9     hypothetical protein SaurJH9_0155
gb|ABR51022.1 Staphylococcus aureus subsp. aureus JH1     conserved hypothetical protein
gb|ABX28215.1 Staphylococcus aureus subsp. aureus USA300_TCH1516     hypothetical protein USA300HOU_0183
gb|EES56552.1 Staphylococcus aureus subsp. aureus TCH70     conserved hypothetical protein
gb|EES94392.1 Staphylococcus aureus subsp. aureus USA300_TCH959     conserved hypothetical protein
gb|EES95940.1 Staphylococcus aureus subsp. aureus TCH130     conserved hypothetical protein
gb|EEV26328.1 Staphylococcus aureus A9781     conserved hypothetical protein
gb|EEV65044.1 Staphylococcus aureus A9763     conserved hypothetical protein
gb|EEV67012.1 Staphylococcus aureus A9719     conserved hypothetical protein
gb|EEV71788.1 Staphylococcus aureus A9299     conserved hypothetical protein
gb|EEV74358.1 Staphylococcus aureus A8115     conserved hypothetical protein
gb|EEV76996.1 Staphylococcus aureus A6300     conserved hypothetical protein
gb|EEV81007.1 Staphylococcus aureus A6224     conserved hypothetical protein
gb|EEV83477.1 Staphylococcus aureus A5948     conserved hypothetical protein
gb|EEV84706.1 Staphylococcus aureus A5937     conserved hypothetical protein
gb|EEW46039.1 Staphylococcus aureus 930918-3     hypothetical protein SA930_0698
gb|EEW48128.1 Staphylococcus aureus D30     hypothetical protein SAD30_1683
gi|13700086 Staphylococcus aureus subsp. aureus N315 NCBI   hypothetical protein
gi|14245937 Staphylococcus aureus subsp. aureus Mu50 NCBI   hypothetical protein
gi|147739664 Staphylococcus aureus subsp. aureus JH9 NCBI   hypothetical protein SaurJH9_0155
gi|148266595 Staphylococcus aureus subsp. aureus JH9 NCBI   hypothetical protein SaurJH9_0155
gi|149945086 Staphylococcus aureus subsp. aureus JH1 NCBI   conserved hypothetical protein
gi|150392634 Staphylococcus aureus subsp. aureus JH1 NCBI   hypothetical protein SaurJH1_0160
gi|156720635 Staphylococcus aureus subsp. aureus Mu3 NCBI   hypothetical protein
gi|156978500 Staphylococcus aureus subsp. aureus Mu3 NCBI   hypothetical protein SAHV_0169
gi|15923160 Staphylococcus aureus subsp. aureus Mu50 NCBI   hypothetical protein SAV0170
gi|15925874 Staphylococcus aureus subsp. aureus N315 NCBI   hypothetical protein SA0164
gi|160367244 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   hypothetical protein USA300HOU_0183
gi|161508435 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   hypothetical protein USA300HOU_0183
gi|21203308 Staphylococcus aureus subsp. aureus MW2 NCBI   hypothetical protein
gi|21281873 Staphylococcus aureus subsp. aureus MW2 NCBI   hypothetical protein MW0144
gi|251803895 Staphylococcus aureus subsp. aureus TCH70 NCBI   conserved hypothetical protein
gi|251812674 Staphylococcus aureus subsp. aureus TCH70 NCBI   conserved hypothetical protein
gi|253316394 Staphylococcus aureus subsp. aureus str. CF-Marseille NCBI   hypothetical protein SauraC_09671
gi|253725663 Staphylococcus aureus subsp. aureus USA300_TCH959 NCBI   conserved hypothetical protein
gi|253727211 Staphylococcus aureus subsp. aureus TCH130 NCBI   conserved hypothetical protein
gi|253730523 Staphylococcus aureus subsp. aureus USA300_TCH959 NCBI   conserved hypothetical protein
gi|253734732 Staphylococcus aureus subsp. aureus TCH130 NCBI   conserved hypothetical protein
gi|255004966 Staphylococcus aureus subsp. aureus Mu50-omega NCBI   hypothetical protein SauraM_00815
gi|257787988 Staphylococcus aureus A9781 NCBI   conserved hypothetical protein
gi|257794016 Staphylococcus aureus A9781 NCBI   conserved hypothetical protein
gi|257840585 Staphylococcus aureus A9763 NCBI   conserved hypothetical protein
gi|257842590 Staphylococcus aureus A9719 NCBI   conserved hypothetical protein
gi|257847792 Staphylococcus aureus A9299 NCBI   conserved hypothetical protein
gi|257850410 Staphylococcus aureus A8115 NCBI   conserved hypothetical protein
gi|257854043 Staphylococcus aureus A6300 NCBI   conserved hypothetical protein
gi|257858119 Staphylococcus aureus A6224 NCBI   conserved hypothetical protein
gi|257860655 Staphylococcus aureus A5948 NCBI   conserved hypothetical protein
gi|257861933 Staphylococcus aureus A5937 NCBI   conserved hypothetical protein
gi|258408576 Staphylococcus aureus A9763 NCBI   conserved hypothetical protein
gi|258421166 Staphylococcus aureus A9719 NCBI   conserved hypothetical protein
gi|258438916 Staphylococcus aureus A9299 NCBI   conserved hypothetical protein
gi|258444151 Staphylococcus aureus A8115 NCBI   conserved hypothetical protein
gi|258447030 Staphylococcus aureus A6300 NCBI   conserved hypothetical protein
gi|258448488 Staphylococcus aureus A6224 NCBI   conserved hypothetical protein
gi|258451607 Staphylococcus aureus A5948 NCBI   conserved hypothetical protein
gi|258455721 Staphylococcus aureus A5937 NCBI   conserved hypothetical protein
gi|259161020 Staphylococcus aureus 930918-3 NCBI   hypothetical protein SA930_0698
gi|259163572 Staphylococcus aureus D30 NCBI   hypothetical protein SAD30_1683
gi|49243489 Staphylococcus aureus subsp. aureus MSSA476 NCBI   hypothetical protein
gi|49485046 Staphylococcus aureus subsp. aureus MSSA476 NCBI   hypothetical protein SAS0145
gi|57285359 Staphylococcus aureus subsp. aureus COL NCBI   hypothetical protein SACOL0156
gi|57651173 Staphylococcus aureus subsp. aureus COL NCBI   hypothetical protein SACOL0156
gi|82655412 Staphylococcus aureus RF122 NCBI   hypothetical protein
gi|82749881 Staphylococcus aureus RF122 NCBI   hypothetical protein SAB0110c
gi|87126395 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   conserved hypothetical protein
gi|87160421 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   hypothetical protein SAUSA300_0172
gi|87201505 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   conserved hypothetical protein
gi|88193947 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   hypothetical protein SAOUHSC_00134
img|637091765 Staphylococcus aureus aureus N315 IMG   hypothetical protein
img|637098669 Staphylococcus aureus aureus Mu50 IMG   hypothetical protein
img|637150939 Staphylococcus aureus aureus COL IMG   hypothetical protein
img|637156347 Staphylococcus aureus aureus MSSA476 IMG   hypothetical protein
img|637297884 Staphylococcus aureus aureus MW2 IMG   hypothetical protein
img|637815072 Staphylococcus aureus RF122 IMG   hypothetical protein
img|637886827 Staphylococcus aureus aureus USA300 IMG   hypothetical protein
img|637892808 Staphylococcus aureus aureus NCTC 8325 IMG   hypothetical protein
img|639108485 Staphylococcus aureus aureus JH1 IMG   conserved hypothetical protein
img|640564485 Staphylococcus aureus aureus JH9 IMG   hypothetical protein
img|640778230 Staphylococcus aureus aureus JH1 IMG   hypothetical protein
img|640902891 Staphylococcus aureus aureus Mu3 IMG   hypothetical protein
img|641308143 Staphylococcus aureus subsp. aureus USA300_TCH1516 IMG   hypothetical protein
img|641771889 Staphylococcus aureus aureus USA300_TCH959 IMG   hypothetical protein
kegg|saa:SAUSA300_0172 Staphylococcus aureus subsp. aureus USA300_FPR3757 KEGG   hypothetical protein
kegg|sab:SAB0110c Staphylococcus aureus RF122 KEGG   hypothetical protein
kegg|sac:SACOL0156 Staphylococcus aureus subsp. aureus COL KEGG   hypothetical protein
kegg|sah:SaurJH1_0160 Staphylococcus aureus subsp. aureus JH1 KEGG   hypothetical protein
kegg|saj:SaurJH9_0155 Staphylococcus aureus subsp. aureus JH9 KEGG   hypothetical protein
kegg|sam:MW0144 Staphylococcus aureus subsp. aureus MW2 KEGG   hypothetical protein
kegg|sao:SAOUHSC_00134 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   hypothetical protein
kegg|sas:SAS0145   KEGG   hypothetical protein
kegg|sau:SA0164   KEGG   hypothetical protein
kegg|sav:SAV0170   KEGG   hypothetical protein
kegg|saw:SAHV_0169 Staphylococcus aureus subsp. aureus Mu3 KEGG   hypothetical protein
kegg|sax:USA300HOU_0183 Staphylococcus aureus subsp. aureus USA300_TCH1516 KEGG   hypothetical protein
ref|NP_370694.1 Staphylococcus aureus subsp. aureus Mu50 RefSeq   hypothetical protein SAV0170
ref|NP_373407.1 Staphylococcus aureus subsp. aureus N315 RefSeq   hypothetical protein SA0164
ref|NP_644959.1 Staphylococcus aureus subsp. aureus MW2 RefSeq   hypothetical protein MW0144
ref|YP_001245538.1 Staphylococcus aureus subsp. aureus JH9 RefSeq   hypothetical protein SaurJH9_0155
ref|YP_001315309.1 Staphylococcus aureus subsp. aureus JH1 RefSeq   hypothetical protein SaurJH1_0160
ref|YP_001440759.1 Staphylococcus aureus subsp. aureus Mu3 RefSeq   hypothetical protein SAHV_0169
ref|YP_001574094.1 Staphylococcus aureus subsp. aureus USA300_TCH1516 RefSeq   hypothetical protein USA300HOU_0183
ref|YP_042267.1 Staphylococcus aureus subsp. aureus MSSA476 RefSeq   hypothetical protein SAS0145
ref|YP_185056.1 Staphylococcus aureus subsp. aureus COL RefSeq   hypothetical protein SACOL0156
ref|YP_415622.1 Staphylococcus aureus RF122 RefSeq   hypothetical protein SAB0110c
ref|YP_492886.1 Staphylococcus aureus subsp. aureus USA300_FPR3757 RefSeq   hypothetical protein SAUSA300_0172
ref|YP_498734.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   hypothetical protein SAOUHSC_00134
ref|ZP_04827147.1 Staphylococcus aureus subsp. aureus TCH70 RefSeq   conserved hypothetical protein
ref|ZP_04839607.1 Staphylococcus aureus subsp. aureus str. CF-Marseille RefSeq   hypothetical protein SauraC_09671
ref|ZP_04864688.1 Staphylococcus aureus subsp. aureus USA300_TCH959 RefSeq   conserved hypothetical protein
ref|ZP_04868897.1 Staphylococcus aureus subsp. aureus TCH130 RefSeq   conserved hypothetical protein
ref|ZP_05143567.2 Staphylococcus aureus subsp. aureus Mu50-omega RefSeq   hypothetical protein SauraM_00815
ref|ZP_05642995.1 Staphylococcus aureus A9781 RefSeq   conserved hypothetical protein
ref|ZP_05680861.1 Staphylococcus aureus A9763 RefSeq   conserved hypothetical protein
ref|ZP_05684093.1 Staphylococcus aureus A9719 RefSeq   conserved hypothetical protein
ref|ZP_05690007.1 Staphylococcus aureus A9299 RefSeq   conserved hypothetical protein
ref|ZP_05692485.1 Staphylococcus aureus A8115 RefSeq   conserved hypothetical protein
ref|ZP_05695180.1 Staphylococcus aureus A6300 RefSeq   conserved hypothetical protein
ref|ZP_05696601.1 Staphylococcus aureus A6224 RefSeq   conserved hypothetical protein
ref|ZP_05699633.1 Staphylococcus aureus A5948 RefSeq   conserved hypothetical protein
ref|ZP_05703676.1 Staphylococcus aureus A5937 RefSeq   conserved hypothetical protein
tr|A5IP39 Staphylococcus aureus (strain JH9) TrEMBL   Putative uncharacterized protein
tr|A6TXV4 Staphylococcus aureus (strain JH1) TrEMBL   Putative uncharacterized protein
tr|A7WXF5 Staphylococcus aureus (strain Mu3 / ATCC 700698) TrEMBL   Putative uncharacterized protein
tr|A8YZ92 Staphylococcus aureus (strain USA300 / TCH1516) TrEMBL   Putative uncharacterized protein
tr|C5N146 Staphylococcus aureus subsp. aureus USA300_TCH959 TrEMBL   Putative uncharacterized protein
tr|C5Q428 Staphylococcus aureus subsp. aureus TCH130 TrEMBL   Putative uncharacterized protein
tr|C5QE46 Staphylococcus aureus subsp. aureus TCH70 TrEMBL   Putative uncharacterized protein
tr|Q2FK92 Staphylococcus aureus (strain USA300) TrEMBL   Putative uncharacterized protein
tr|Q2G1I8 Staphylococcus aureus (strain NCTC 8325) TrEMBL   Putative uncharacterized protein
tr|Q2YV09 Staphylococcus aureus (strain bovine RF122 / ET3-1) TrEMBL   Putative uncharacterized protein
tr|Q5HJK1 Staphylococcus aureus (strain COL) TrEMBL   Putative uncharacterized protein
tr|Q6GCV6 Staphylococcus aureus (strain MSSA476) TrEMBL   Putative uncharacterized protein
tr|Q7A1Y6 Staphylococcus aureus (strain MW2) TrEMBL   Putative uncharacterized protein MW0144
tr|Q7A822 Staphylococcus aureus (strain N315) TrEMBL   Putative uncharacterized protein SA0164
tr|Q99X51 Staphylococcus aureus (strain Mu50 / ATCC 700699) TrEMBL   Putative uncharacterized protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search