The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|158879.11.peg.172: Staphylococcus aureus subsp. aureus N315

This feature in The SEED Viewer

NCBI Taxonomy Id: 158879

Current Assignment: hypothetical protein
Translate Function Assignments



Context on contig NC_002745 from base 182832 to 193336 (10505 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
164 182832 183977 1146 +           Capsular polysaccharide synthesis enzyme Cap8P gene_name|capP, locus|SA0159, protein_id|NP_373401.1, gi|15925868, geneID|1122934
165 184368 184042 327 - 64     1: 1 dlit(14570922)
dlit(15520015)
Heme-degrading monooxygenase, staphylobilin-producing (EC 1.14.99.48) # IsdI locus|SA0160, protein_id|NP_373402.1, gi|15925869, geneID|1122935
166 184758 184375 384 - 6     1: 1   Inner membrane protein YbaN locus|SA0161, protein_id|NP_373403.1, gi|15925870, geneID|1122936
167 185185 186672 1488 + 426     3: 3 6 7   Aldehyde dehydrogenase B (EC 1.2.1.22) gene_name|aldA, locus|SA0162, protein_id|NP_373404.1, gi|15925871, geneID|1122937
168 187319 188278 960 + 646     3: 4 8 5   Cobalt-zinc-cadmium resistance protein locus|SA0163, protein_id|NP_373405.1, gi|15925872, geneID|1122938
169 188407 188270 138 - -9         hypothetical protein  
170 188346 188525 180 + -62         hypothetical protein  
171 188543 188388 156 - -138         hypothetical protein locus|SAS005, protein_id|NP_373406.1, gi|15925873, geneID|1122939
172 188438 188590 153 + -106         hypothetical protein  
173 188776 188573 204 - -18         FIG01108246: hypothetical protein locus|SA0164, protein_id|NP_373407.1, gi|15925874, geneID|1122940
174 188955 189467 513 + 178         FIG01108032: hypothetical protein locus|SA0165, protein_id|NP_373408.1, gi|15925875, geneID|1122941
175 189809 190549 741 + 341         ABC transporter, ATP-binding protein locus|SA0166, protein_id|NP_373409.1, gi|15925876, geneID|1122942
176 190563 191534 972 + 13         FIG01108009: hypothetical protein locus|SA0167, protein_id|NP_373410.1, gi|15925877, geneID|1122943
177 191531 192292 762 + -4         ABC transporter, permease protein (cluster 10, nitrate/sulfonate/bicarbonate) locus|SA0168, protein_id|NP_373411.1, gi|15925878, geneID|1122944
178 192302 193336 1035 + 9     1: 2   Acyl-CoA dehydrogenase, short-chain specific (EC 1.3.99.2) locus|SA0169, protein_id|NP_373412.1, gi|15925879, geneID|1122945

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|158879.11.peg.172 hypothetical protein
MQVGVWAPTKRNWIPNFYRQCKLGWDNEINFAKISFLSHSHVCFGLCCII

MD5 = faf55a7faa4fb82072b3ea8bff5b966e


  DNA Sequence

>fig|158879.11.peg.172 hypothetical protein
atgcaagttggggtgtgggccccaacaaagagaaattggattcccaatttctacagacaa
tgcaagttggggtgggacaacgaaataaattttgcgaaaatatcatttctgtcccactcc
cacgtttgttttggattatgttgcatcatttaa


  DNA with Flanking Sequence

>fig|158879.11.peg.172 hypothetical protein
tcattttacgtggtggttataaaattacgcgtaatgcgtggttaattttaatggaaagtg
tgcctcaacatttggatactgatcaaattatggcagatattaaaaacatagatggcatat
tagatgtacatgaatttcatttgtggagtattacaacagagcattattcattaagtgccc
atgttgtgttagataaaaaatatgagggtgatgattatcaagcgattgatcaagtatcat
cattgttgaaagaaaaatatggcattgcacattcaacgttgcaaattgaaaacttgcaat
tgaatccattagatgagccatacttcgacaaattaacataaataaaacattgtacaggct
gggacataaatcaatgttctatgctctacgaagttatattggcagtagttgactgaacga
aaatgcgcttgtaacaagcttttttcaattctagtcaggggccccaacacagagaatttc
gaaaagaaattctacaggcaatgcaagttggggtgtgggccccaacaaagagaaattgga
ttcccaatttctacagacaatgcaagttggggtgggacaacgaaataaattttgcgaaaa
tatcatttctgtcccactcccacgtttgttttggattatgttgcatcatttaaatgattt
tcgtcaatttctttgatgctatctacatctaacacgacatctttaggtttcaaaatatga
atatgtttttcatcatttgtatgtaaaatgcgttctatgatgtatctttgaccggccatt
gtttctacagcaatctttttgtttctagctaaacttgctacgacagattctttatccata
atgatagccccctatatatatgtttatttacttataccctaacatgatttttatactctt
tgaaaatatattttacagaattttatctaaatatttaaaaaaatcgctcaatatccttgt
aatccgataagaattatagtaatattttttcaaccattgttataggaggtcttattaatg
acattatttttattagaagctaacaatcttgattttgcatcaacgaaagaagaactagaa
gcaaaggcagcatcactatctacgaagacaattccaacattaattgaagtacaagctact
gaaaatttaactc


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
fig|158878.14.peg.170 Staphylococcus aureus subsp. aureus Mu50 FIG   hypothetical protein
fig|196620.5.peg.159 Staphylococcus aureus subsp. aureus MW2 FIG   hypothetical protein
fig|418127.6.peg.169 Staphylococcus aureus subsp. aureus Mu3 FIG   hypothetical protein
fig|585891.3.peg.170 Staphylococcus aureus subsp. aureus Mu50-omega FIG   hypothetical protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search