The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|158879.11.peg.168: Staphylococcus aureus subsp. aureus N315

This feature in The SEED Viewer

NCBI Taxonomy Id: 158879

Current Assignment: Cobalt-zinc-cadmium resistance protein
Translate Function Assignments



Context on contig NC_002745 from base 181493 to 193336 (11844 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
163 181493 182755 1263 +         dlit(21454499) UDP-N-acetyl-D-mannosamine dehydrogenase (EC 1.1.1.336) gene_name|capO, locus|SA0158, protein_id|NP_373400.1, gi|15925867, geneID|1122933
164 182832 183977 1146 + 76         Capsular polysaccharide synthesis enzyme Cap8P gene_name|capP, locus|SA0159, protein_id|NP_373401.1, gi|15925868, geneID|1122934
165 184368 184042 327 - 64     1: 1 dlit(14570922)
dlit(15520015)
Heme-degrading monooxygenase, staphylobilin-producing (EC 1.14.99.48) # IsdI locus|SA0160, protein_id|NP_373402.1, gi|15925869, geneID|1122935
166 184758 184375 384 - 6     1: 1   Inner membrane protein YbaN locus|SA0161, protein_id|NP_373403.1, gi|15925870, geneID|1122936
167 185185 186672 1488 + 426     3: 4 6 7   Aldehyde dehydrogenase B (EC 1.2.1.22) gene_name|aldA, locus|SA0162, protein_id|NP_373404.1, gi|15925871, geneID|1122937
168 187319 188278 960 + 646     3: 3 8 5   Cobalt-zinc-cadmium resistance protein locus|SA0163, protein_id|NP_373405.1, gi|15925872, geneID|1122938
169 188407 188270 138 - -9         hypothetical protein  
170 188346 188525 180 + -62         hypothetical protein  
171 188543 188388 156 - -138         hypothetical protein locus|SAS005, protein_id|NP_373406.1, gi|15925873, geneID|1122939
172 188438 188590 153 + -106         hypothetical protein  
173 188776 188573 204 - -18         FIG01108246: hypothetical protein locus|SA0164, protein_id|NP_373407.1, gi|15925874, geneID|1122940
174 188955 189467 513 + 178         FIG01108032: hypothetical protein locus|SA0165, protein_id|NP_373408.1, gi|15925875, geneID|1122941
175 189809 190549 741 + 341         ABC transporter, ATP-binding protein locus|SA0166, protein_id|NP_373409.1, gi|15925876, geneID|1122942
176 190563 191534 972 + 13         FIG01108009: hypothetical protein locus|SA0167, protein_id|NP_373410.1, gi|15925877, geneID|1122943
177 191531 192292 762 + -4         ABC transporter, permease protein (cluster 10, nitrate/sulfonate/bicarbonate) locus|SA0168, protein_id|NP_373411.1, gi|15925878, geneID|1122944
178 192302 193336 1035 + 9     1: 2   Acyl-CoA dehydrogenase, short-chain specific (EC 1.3.99.2) locus|SA0169, protein_id|NP_373412.1, gi|15925879, geneID|1122945

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
Cobalt-zinc-cadmium_resistance OlgaV Cobalt-zinc-cadmium resistance protein
Gra Cobalt-zinc-cadmium resistance protein
Glutathione-regulated_potassium-efflux_system_and_associated_functions OlgaV *Cobalt-zinc-cadmium resistance protein


  Protein Sequence

>fig|158879.11.peg.168 Cobalt-zinc-cadmium resistance protein
MNGKKANTINRYKYFHHVNHQKIQQSSKKTLWASLIITLLFTVIEFVGGLVSNSLALLSD
SFHMLSDVLALGLSMLAIYFASKKPTARYTFGYLRFEILVAFLNGLALIVISIWILYEAI
VRIIYPQPIESGIMFMIASIGLLVNIILTIILVRSLKQEDNINIQSALWHFMGDLLNSIG
VIVAVVLIYFTGWRIIDPIISIVISLIILRGGYKITRNAWLILMESVPQHLDTDQIMADI
KNIDGILDVHEFHLWSITTEHYSLSAHVVLDKKYEGDDYQAIDQVSSLLKEKYGIAHSTL
QIENLQLNPLDEPYFDKLT

MD5 = be9c499c4d99580222038a1577be4ed2


  DNA Sequence

>fig|158879.11.peg.168 Cobalt-zinc-cadmium resistance protein
atgaatgggaaaaaggcaaatacgataaacagatacaaatattttcatcatgtcaatcat
caaaaaattcaacaaagttctaaaaagacgctgtgggcatcactaatcatcacattgtta
tttacagtgattgaatttgtcggaggtttagtatctaattcattggcattactgtcagat
tcatttcatatgcttagtgatgtattagcacttggtttatctatgttggccatttatttt
gcaagtaaaaagccgactgcacgatacacatttggatatttaagatttgagatattagtt
gcatttttaaatggtttagcattaattgtaatttcaatctggattttatatgaagctatt
gtacgtattatttatccgcaaccaattgaaagtggcattatgtttatgattgctagtatt
ggtttactcgttaatattattttgacaattatccttgtaaggtctttaaaacaagaagac
aatatcaatattcaaagtgcattatggcatttcatgggagacttattgaactctattggt
gtcatcgttgcagttgtattgatttactttacaggatggcgcatcatcgacccaatcatt
agtattgtaatttcactcatcattttacgtggtggttataaaattacgcgtaatgcgtgg
ttaattttaatggaaagtgtgcctcaacatttggatactgatcaaattatggcagatatt
aaaaacatagatggcatattagatgtacatgaatttcatttgtggagtattacaacagag
cattattcattaagtgcccatgttgtgttagataaaaaatatgagggtgatgattatcaa
gcgattgatcaagtatcatcattgttgaaagaaaaatatggcattgcacattcaacgttg
caaattgaaaacttgcaattgaatccattagatgagccatacttcgacaaattaacataa


  DNA with Flanking Sequence

>fig|158879.11.peg.168 Cobalt-zinc-cadmium resistance protein
aggatggtttttaattgcaaatcatcttactgctgtttttaattatgctaatttgcgatg
cagctattataaggacagagttgtttatgaattgtggtgatttagaaatatgaagttcaa
tatgcaaagtcatcgtttgttttaatatgtggaacaatcattaaagttattgtgattttt
tgaacttaatgaaactaaacaataaatttgagatacttttttgtcatttttatgtaacta
acacaataatctcgtacattattaaaattttctatatgatagggataaagtaaagagcga
atgtgctgtaaaagtttttccaaggtgatattacataaaggtataaagggtaaagattaa
ttagttgtcatgtaaaggacgatgatgtataaatcatggttaattacggaagcattaata
ttaatctgagaagctataaagaattatttttaaaagcgacaatattaaatacgacgcatt
tatttaggagtggcaaacgtatgaatgggaaaaaggcaaatacgataaacagatacaaat
attttcatcatgtcaatcatcaaaaaattcaacaaagttctaaaaagacgctgtgggcat
cactaatcatcacattgttatttacagtgattgaatttgtcggaggtttagtatctaatt
cattggcattactgtcagattcatttcatatgcttagtgatgtattagcacttggtttat
ctatgttggccatttattttgcaagtaaaaagccgactgcacgatacacatttggatatt
taagatttgagatattagttgcatttttaaatggtttagcattaattgtaatttcaatct
ggattttatatgaagctattgtacgtattatttatccgcaaccaattgaaagtggcatta
tgtttatgattgctagtattggtttactcgttaatattattttgacaattatccttgtaa
ggtctttaaaacaagaagacaatatcaatattcaaagtgcattatggcatttcatgggag
acttattgaactctattggtgtcatcgttgcagttgtattgatttactttacaggatggc
gcatcatcgacccaatcattagtattgtaatttcactcatcattttacgtggtggttata
aaattacgcgtaatgcgtggttaattttaatggaaagtgtgcctcaacatttggatactg
atcaaattatggcagatattaaaaacatagatggcatattagatgtacatgaatttcatt
tgtggagtattacaacagagcattattcattaagtgcccatgttgtgttagataaaaaat
atgagggtgatgattatcaagcgattgatcaagtatcatcattgttgaaagaaaaatatg
gcattgcacattcaacgttgcaaattgaaaacttgcaattgaatccattagatgagccat
acttcgacaaattaacataaataaaacattgtacaggctgggacataaatcaatgttcta
tgctctacgaagttatattggcagtagttgactgaacgaaaatgcgcttgtaacaagctt
ttttcaattctagtcaggggccccaacacagagaatttcgaaaagaaattctacaggcaa
tgcaagttggggtgtgggccccaacaaagagaaattggattcccaatttctacagacaat
gcaagttggggtgggacaacgaaataaattttgcgaaaatatcatttctgtcccactccc
acgtttgttttggattatgttgcatcatttaaatgattttcgtcaatttctttgatgcta
tctacatctaacacgacatctttaggtttcaaaatatgaatatgtttttcatcatttgta
tgtaaaatgcgttctatgatgtatctttgaccggccattgtttctacagcaatctttttg
tttctagctaaacttgctacgacagattctttatccataa


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0006812       P:cation transport
GO:0008324       F:cation transmembrane transporter activity
GO:0016020       C:membrane
cmr|NT01SA0172 Staphylococcus aureus N315     cation efflux family protein
cmr|NT02SA0165 Staphylococcus aureus Mu50     cation-efflux system membrane protein CzcD
dbj|BAB41383.1 Staphylococcus aureus subsp. aureus N315     SA0163
dbj|BAB56330.1 Staphylococcus aureus subsp. aureus Mu50     similar to cation-efflux system membrane protein CzcD
dbj|BAF77050.1 Staphylococcus aureus subsp. aureus Mu3     hypothetical protein
fig|158878.1.peg.168 Staphylococcus aureus subsp. aureus Mu50 FIG   Cobalt-zinc-cadmium resistance protein
fig|158878.14.peg.166 Staphylococcus aureus subsp. aureus Mu50 FIG   Cobalt-zinc-cadmium resistance protein
fig|158879.1.peg.166 Staphylococcus aureus subsp. aureus N315 FIG   Cobalt-zinc-cadmium resistance protein
fig|359786.13.peg.194 Staphylococcus aureus subsp. aureus JH9 FIG   Cobalt-zinc-cadmium resistance protein
fig|359787.11.peg.191 Staphylococcus aureus subsp. aureus JH1 FIG   Cobalt-zinc-cadmium resistance protein
fig|418127.4.peg.150 Staphylococcus aureus subsp. aureus Mu3 FIG   Cobalt-zinc-cadmium resistance protein
fig|418127.6.peg.165 Staphylococcus aureus subsp. aureus Mu3 FIG   Cobalt-zinc-cadmium resistance protein
fig|505321.3.peg.1833 Staphylococcus aureus subsp. aureus str. CF-Marseille FIG   Cobalt-zinc-cadmium resistance protein
fig|553565.3.peg.2486 Staphylococcus aureus A5937 FIG   Cobalt-zinc-cadmium resistance protein
fig|553568.3.peg.801 Staphylococcus aureus A6224 FIG   Cobalt-zinc-cadmium resistance protein
fig|553571.3.peg.2071 Staphylococcus aureus A6300 FIG   Cobalt-zinc-cadmium resistance protein
fig|553573.3.peg.1962 Staphylococcus aureus A8115 FIG   Cobalt-zinc-cadmium resistance protein
fig|553574.3.peg.1727 Staphylococcus aureus A8117 FIG   Cobalt-zinc-cadmium resistance protein
fig|553577.3.peg.842 Staphylococcus aureus A8796 FIG   Cobalt-zinc-cadmium resistance protein
fig|553580.3.peg.578 Staphylococcus aureus A8819 FIG   Cobalt-zinc-cadmium resistance protein
fig|553581.3.peg.2093 Staphylococcus aureus A9299 FIG   Cobalt-zinc-cadmium resistance protein
fig|553588.3.peg.1479 Staphylococcus aureus A9719 FIG   Cobalt-zinc-cadmium resistance protein
fig|553592.3.peg.856 Staphylococcus aureus A9763 FIG   Cobalt-zinc-cadmium resistance protein
fig|553596.3.peg.893 Staphylococcus aureus A9781 FIG   Cobalt-zinc-cadmium resistance protein
fig|553601.3.peg.31 Staphylococcus aureus A10102 FIG   Cobalt-zinc-cadmium resistance protein
fig|585891.3.peg.166 Staphylococcus aureus subsp. aureus Mu50-omega FIG   Cobalt-zinc-cadmium resistance protein
fig|680649.3.peg.1640 Staphylococcus aureus subsp. aureus MR1 FIG   Cobalt-zinc-cadmium resistance protein
fig|681288.4.peg.135 Staphylococcus aureus subsp. aureus ED98 FIG   Cobalt-zinc-cadmium resistance protein
fig|703339.3.peg.169 Staphylococcus aureus 04-02981 FIG   Cobalt-zinc-cadmium resistance protein
gb|ABQ47961.1 Staphylococcus aureus subsp. aureus JH9     cation diffusion facilitator family transporter
gb|ABR51021.1 Staphylococcus aureus subsp. aureus JH1     cation diffusion facilitator family transporter
gb|EEV26329.1 Staphylococcus aureus A9781     cation efflux protein
gb|EEV65043.1 Staphylococcus aureus A9763     cation efflux protein
gb|EEV67011.1 Staphylococcus aureus A9719     cation efflux family protein
gb|EEV71787.1 Staphylococcus aureus A9299     cation efflux family protein
gb|EEV74357.1 Staphylococcus aureus A8115     cation efflux family protein
gb|EEV76995.1 Staphylococcus aureus A6300     cation efflux family protein
gb|EEV81006.1 Staphylococcus aureus A6224     cation efflux family protein
gb|EEV84705.1 Staphylococcus aureus A5937     cation efflux family protein
gi|13700084 Staphylococcus aureus subsp. aureus N315 NCBI   SA0163
gi|14245935 Staphylococcus aureus subsp. aureus Mu50 NCBI   similar to cation-efflux system membrane protein CzcD
gi|147739663 Staphylococcus aureus subsp. aureus JH9 NCBI   cation diffusion facilitator family transporter
gi|148266594 Staphylococcus aureus subsp. aureus JH9 NCBI   cation diffusion facilitator family transporter
gi|149945085 Staphylococcus aureus subsp. aureus JH1 NCBI   cation diffusion facilitator family transporter
gi|150392633 Staphylococcus aureus subsp. aureus JH1 NCBI   cation diffusion facilitator family transporter
gi|156720633 Staphylococcus aureus subsp. aureus Mu3 NCBI   hypothetical protein
gi|156978498 Staphylococcus aureus subsp. aureus Mu3 NCBI   hypothetical protein SAHV_0167
gi|15923158 Staphylococcus aureus subsp. aureus Mu50 NCBI   cation-efflux system membrane protein CzcD
gi|15925872 Staphylococcus aureus subsp. aureus N315 NCBI   hypothetical protein SA0163
gi|253316300 Staphylococcus aureus subsp. aureus str. CF-Marseille NCBI   hypothetical protein SauraC_09201
gi|255004965 Staphylococcus aureus subsp. aureus Mu50-omega NCBI   hypothetical protein SauraM_00810
gi|257787989 Staphylococcus aureus A9781 NCBI   cation efflux protein
gi|257794017 Staphylococcus aureus A9781 NCBI   cation efflux protein
gi|257840584 Staphylococcus aureus A9763 NCBI   cation efflux protein
gi|257842589 Staphylococcus aureus A9719 NCBI   cation efflux family protein
gi|257847791 Staphylococcus aureus A9299 NCBI   cation efflux family protein
gi|257850409 Staphylococcus aureus A8115 NCBI   cation efflux family protein
gi|257854042 Staphylococcus aureus A6300 NCBI   cation efflux family protein
gi|257858118 Staphylococcus aureus A6224 NCBI   cation efflux family protein
gi|257861932 Staphylococcus aureus A5937 NCBI   cation efflux family protein
gi|258408575 Staphylococcus aureus A9763 NCBI   cation efflux protein
gi|258421165 Staphylococcus aureus A9719 NCBI   cation efflux family protein
gi|258438915 Staphylococcus aureus A9299 NCBI   cation efflux family protein
gi|258444150 Staphylococcus aureus A8115 NCBI   cation efflux family protein
gi|258447029 Staphylococcus aureus A6300 NCBI   cation efflux family protein
gi|258448487 Staphylococcus aureus A6224 NCBI   cation efflux family protein
gi|258455720 Staphylococcus aureus A5937 NCBI   cation efflux family protein
img|637091763 Staphylococcus aureus aureus N315 IMG   hypothetical protein
img|637098667 Staphylococcus aureus aureus Mu50 IMG   similar to cation-efflux system membrane protein CzcD
img|640564484 Staphylococcus aureus aureus JH9 IMG   cation diffusion facilitator family transporter
img|640778229 Staphylococcus aureus aureus JH1 IMG   cation diffusion facilitator family transporter
img|640902889 Staphylococcus aureus aureus Mu3 IMG   hypothetical protein
kegg|sah:SaurJH1_0159 Staphylococcus aureus subsp. aureus JH1 KEGG   cation diffusion facilitator family transporter
kegg|saj:SaurJH9_0154 Staphylococcus aureus subsp. aureus JH9 KEGG   cation diffusion facilitator family transporter
kegg|sau:SA0163   KEGG   hypothetical protein
kegg|sav:SAV0168   KEGG   cation-efflux system membrane protein CzcD
kegg|saw:SAHV_0167 Staphylococcus aureus subsp. aureus Mu3 KEGG   hypothetical protein
ref|NP_370692.1 Staphylococcus aureus subsp. aureus Mu50 RefSeq   cation-efflux system membrane protein CzcD
ref|NP_373405.1 Staphylococcus aureus subsp. aureus N315 RefSeq   hypothetical protein SA0163
ref|YP_001245537.1 Staphylococcus aureus subsp. aureus JH9 RefSeq   cation diffusion facilitator family transporter
ref|YP_001315308.1 Staphylococcus aureus subsp. aureus JH1 RefSeq   cation diffusion facilitator family transporter
ref|YP_001440757.1 Staphylococcus aureus subsp. aureus Mu3 RefSeq   hypothetical protein SAHV_0167
ref|ZP_04839513.1 Staphylococcus aureus subsp. aureus str. CF-Marseille RefSeq   hypothetical protein SauraC_09201
ref|ZP_05143566.2 Staphylococcus aureus subsp. aureus Mu50-omega RefSeq   hypothetical protein SauraM_00810
ref|ZP_05642996.1 Staphylococcus aureus A9781 RefSeq   cation efflux protein
ref|ZP_05680860.1 Staphylococcus aureus A9763 RefSeq   cation efflux protein
ref|ZP_05684092.1 Staphylococcus aureus A9719 RefSeq   cation efflux family protein
ref|ZP_05690006.1 Staphylococcus aureus A9299 RefSeq   cation efflux family protein
ref|ZP_05692484.1 Staphylococcus aureus A8115 RefSeq   cation efflux family protein
ref|ZP_05695179.1 Staphylococcus aureus A6300 RefSeq   cation efflux family protein
ref|ZP_05696600.1 Staphylococcus aureus A6224 RefSeq   cation efflux family protein
ref|ZP_05703675.1 Staphylococcus aureus A5937 RefSeq   cation efflux family protein
tr|A5IP38 Staphylococcus aureus (strain JH9) TrEMBL   Cation diffusion facilitator family transporter
tr|A6TXV3 Staphylococcus aureus (strain JH1) TrEMBL   Cation diffusion facilitator family transporter
tr|A7WXF0 Staphylococcus aureus (strain Mu3 / ATCC 700698) TrEMBL   Putative uncharacterized protein
tr|Q7A824 Staphylococcus aureus (strain N315) TrEMBL   SA0163 protein
tr|Q99X53 Staphylococcus aureus (strain Mu50 / ATCC 700699) TrEMBL   Similar to cation-efflux system membrane protein CzcD


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search