The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|158879.11.peg.167: Staphylococcus aureus subsp. aureus N315

This feature in The SEED Viewer

NCBI Taxonomy Id: 158879

Current Assignment: Aldehyde dehydrogenase B (EC 1.2.1.22)
Translate Function Assignments



Context on contig NC_002745 from base 179995 to 192292 (12298 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
161 179995 180552 558 +           Capsular polysaccharide synthesis enzyme CapM gene_name|capM, locus|SA0156, protein_id|NP_373398.1, gi|15925865, geneID|1122931
162 180552 181439 888 + -1         Capsular polysaccharide synthesis enzyme CapN gene_name|capN, locus|SA0157, protein_id|NP_373399.1, gi|15925866, geneID|1122932
163 181493 182755 1263 + 53       dlit(21454499) UDP-N-acetyl-D-mannosamine dehydrogenase (EC 1.1.1.336) gene_name|capO, locus|SA0158, protein_id|NP_373400.1, gi|15925867, geneID|1122933
164 182832 183977 1146 + 76         Capsular polysaccharide synthesis enzyme Cap8P gene_name|capP, locus|SA0159, protein_id|NP_373401.1, gi|15925868, geneID|1122934
165 184368 184042 327 - 64     1: 1 dlit(14570922)
dlit(15520015)
Heme-degrading monooxygenase, staphylobilin-producing (EC 1.14.99.48) # IsdI locus|SA0160, protein_id|NP_373402.1, gi|15925869, geneID|1122935
166 184758 184375 384 - 6     1: 1   Inner membrane protein YbaN locus|SA0161, protein_id|NP_373403.1, gi|15925870, geneID|1122936
167 185185 186672 1488 + 426     3: 3 5 6   Aldehyde dehydrogenase B (EC 1.2.1.22) gene_name|aldA, locus|SA0162, protein_id|NP_373404.1, gi|15925871, geneID|1122937
168 187319 188278 960 + 646     3: 2 7 4   Cobalt-zinc-cadmium resistance protein locus|SA0163, protein_id|NP_373405.1, gi|15925872, geneID|1122938
169 188407 188270 138 - -9         hypothetical protein  
170 188346 188525 180 + -62         hypothetical protein  
171 188543 188388 156 - -138         hypothetical protein locus|SAS005, protein_id|NP_373406.1, gi|15925873, geneID|1122939
172 188438 188590 153 + -106         hypothetical protein  
173 188776 188573 204 - -18         FIG01108246: hypothetical protein locus|SA0164, protein_id|NP_373407.1, gi|15925874, geneID|1122940
174 188955 189467 513 + 178         FIG01108032: hypothetical protein locus|SA0165, protein_id|NP_373408.1, gi|15925875, geneID|1122941
175 189809 190549 741 + 341         ABC transporter, ATP-binding protein locus|SA0166, protein_id|NP_373409.1, gi|15925876, geneID|1122942
176 190563 191534 972 + 13         FIG01108009: hypothetical protein locus|SA0167, protein_id|NP_373410.1, gi|15925877, geneID|1122943
177 191531 192292 762 + -4         ABC transporter, permease protein (cluster 10, nitrate/sulfonate/bicarbonate) locus|SA0168, protein_id|NP_373411.1, gi|15925878, geneID|1122944

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
Glycerolipid_and_Glycerophospholipid_Metabolism_in_Bacteria OlgaZ Aldehyde dehydrogenase B (EC 1.2.1.22)
Methylglyoxal_Metabolism OlgaZ Aldehyde dehydrogenase B (EC 1.2.1.22)
L-dopamine_complete_genomes Ravcheev_Dmitry_user Aldehyde dehydrogenase B (EC 1.2.1.22)


  Protein Sequence

>fig|158879.11.peg.167 Aldehyde dehydrogenase B (EC 1.2.1.22)
MAVNVRDYIAENYGLFINGEFVKGSSDETIEVTNPATGETLSHITRAKDKDVDHAVKVAQ
EAFESWSLTSKSERAQMLRDIGDKLMAQKDKIAMIETLNNGKPIRETTAIDIPFAARHFH
YFASVIETEEGTVNDIDKDTMSIVRHEPIGVVGAVVAWNFPMLLAAWKIAPAIAAGNTIV
IQPSSSTPLSLLEVAKIFQEVLPKGVVNILTGKGSESGNAIFNHDGVDKLSFTGSTDVGY
QVAEAAAKHLVPATLELGGKSANIILDDANLDLAVEGIQLGILFNQGEVCSAGSRLLVHE
KIYDQLVPRLQEAFSNIKVGDPQDEATQMGSQTGKDQLDKIQSYIDAAKESDAQILAGGH
RLTENGLDKGFFFEPTLIAVPDNHHKLAQEEIFGPVLTVIKVKDDQEAIDIANDSEYGLA
GGVFSQNITRALNIAKAVRTGRIWINTYNQVPEGAPFGGYKKSGIGRETYKGALSNYQQV
KNIYIDTSNALKGLY

MD5 = ef34db267e1bf13a0f2615aa7c8be627


  DNA Sequence

>fig|158879.11.peg.167 Aldehyde dehydrogenase B (EC 1.2.1.22)
atggcagtaaacgttcgagattatattgcagagaattatggtttatttatcaatggggaa
tttgttaaaggtagcagtgacgaaacaatcgaagtgactaatccagcaactggagaaaca
ctatcacatattacaagagcaaaagataaagatgtcgatcatgcagtcaaagtggcgcaa
gaggcatttgaatcatggtcattaacttctaaatcagaacgtgcacaaatgttgcgtgat
attggtgataaattaatggcacaaaaagataaaattgcaatgattgaaacattaaataat
ggtaaaccgattcgtgagacaacagcaattgatattccatttgctgcaagacatttccat
tatttcgcaagtgttattgaaacagaagaaggtacagtaaatgatatcgataaagacaca
atgagtatcgtacgacatgagccgattggcgtcgtaggtgctgttgttgcttggaacttc
ccaatgctattagctgcatggaagattgcgccagccattgctgcaggtaatacaattgtg
attcaaccttcgtcttcaacaccattaagtttattggaagttgctaaaattttccaagag
gtattacctaaaggtgttgtcaatatactaacgggtaaaggttcagaatcaggtaatgca
attttcaatcatgatggtgtagataaattatcatttacgggctcaactgatgtaggttat
caagttgccgaagctgcagcaaaacatctagtacccgctacattagagcttggtggtaaa
agcgccaatatcatattagatgatgctaatttagaccttgcagttgaaggtattcagtta
ggtattttattcaaccaaggtgaagtatgtagtgcaggttctcgattattagttcatgaa
aaaatttatgatcaattggtgccacgtttacaagaggcattttcaaatattaaagttgga
gatccacaagatgaagctacacaaatgggtagtcaaactggtaaggatcaattagataaa
attcaatcatatattgatgcagcaaaagaatcagatgcacaaattttagcaggtggtcat
cgcttaactgaaaatggattagataaagggttcttctttgagccgacattaattgctgtg
ccagacaatcatcacaaattagcacaagaagaaatatttggaccagtgttaacagtgatt
aaagtgaaggacgatcaagaagcaattgatatagctaatgattctgagtatggtttagca
ggcggtgtattttctcaaaatatcacacgtgcattaaatattgctaaagctgtacgtaca
ggacgtatttggattaacacttacaaccaagtaccagaaggcgcaccatttggtggttat
aaaaaatcaggtatcggtcgagaaacttataaaggtgcgttaagtaactatcaacaagtt
aaaaatatttatattgatacaagcaatgctttaaaaggtttgtactag


  DNA with Flanking Sequence

>fig|158879.11.peg.167 Aldehyde dehydrogenase B (EC 1.2.1.22)
agtaaaggtaatacggcacctgcaataccaagcgctgtaaatattaagccaataacgatt
aaaataagtcgcattgaaaaaactccattctagtactaatgcgcatgtaatattgtttta
gtaatataactcatgctaaatataatgtgtatgataagtgcaatgactcagtaaaatgaa
acgttgttgaattattcttgtcccattaacgcattttaagcgcgactttcataacaacca
aactatttaatgagaattattctcaagtattatagttatattatgtgttttatttttgaa
aagtgcaatatgttttcgaaaataagattatttttatgtgcaaaaacgacgcaaaagttt
taaaaatgagacttctgtgagctgattattttataaaatgtaaacgcttactatataatg
tgaatcatatcgtttaaaagcattattaaatatgatgctaagagatttatattatagcca
ataaacaaaggagagataatatggcagtaaacgttcgagattatattgcagagaattatg
gtttatttatcaatggggaatttgttaaaggtagcagtgacgaaacaatcgaagtgacta
atccagcaactggagaaacactatcacatattacaagagcaaaagataaagatgtcgatc
atgcagtcaaagtggcgcaagaggcatttgaatcatggtcattaacttctaaatcagaac
gtgcacaaatgttgcgtgatattggtgataaattaatggcacaaaaagataaaattgcaa
tgattgaaacattaaataatggtaaaccgattcgtgagacaacagcaattgatattccat
ttgctgcaagacatttccattatttcgcaagtgttattgaaacagaagaaggtacagtaa
atgatatcgataaagacacaatgagtatcgtacgacatgagccgattggcgtcgtaggtg
ctgttgttgcttggaacttcccaatgctattagctgcatggaagattgcgccagccattg
ctgcaggtaatacaattgtgattcaaccttcgtcttcaacaccattaagtttattggaag
ttgctaaaattttccaagaggtattacctaaaggtgttgtcaatatactaacgggtaaag
gttcagaatcaggtaatgcaattttcaatcatgatggtgtagataaattatcatttacgg
gctcaactgatgtaggttatcaagttgccgaagctgcagcaaaacatctagtacccgcta
cattagagcttggtggtaaaagcgccaatatcatattagatgatgctaatttagaccttg
cagttgaaggtattcagttaggtattttattcaaccaaggtgaagtatgtagtgcaggtt
ctcgattattagttcatgaaaaaatttatgatcaattggtgccacgtttacaagaggcat
tttcaaatattaaagttggagatccacaagatgaagctacacaaatgggtagtcaaactg
gtaaggatcaattagataaaattcaatcatatattgatgcagcaaaagaatcagatgcac
aaattttagcaggtggtcatcgcttaactgaaaatggattagataaagggttcttctttg
agccgacattaattgctgtgccagacaatcatcacaaattagcacaagaagaaatatttg
gaccagtgttaacagtgattaaagtgaaggacgatcaagaagcaattgatatagctaatg
attctgagtatggtttagcaggcggtgtattttctcaaaatatcacacgtgcattaaata
ttgctaaagctgtacgtacaggacgtatttggattaacacttacaaccaagtaccagaag
gcgcaccatttggtggttataaaaaatcaggtatcggtcgagaaacttataaaggtgcgt
taagtaactatcaacaagttaaaaatatttatattgatacaagcaatgctttaaaaggtt
tgtactagaataaatatcgtttctgaagcgtgtttgtaggtcagtctagcggtaagtctt
aacatttaacggcgttgtttagattttaagcaaaacaaaatatataggaacacgtatcat
gatattaggatataatgactaaaataatagcagtaggatggtttttaattgcaaatcatc
ttactgctgtttttaattatgctaatttgcgatgcagctattataaggacagagttgttt
atgaattgtggtgatttagaaatatgaagttcaatatgcaaagtcatcgtttgttttaat
atgtggaacaatcattaaagttattgtgattttttgaacttaatgaaactaaacaataaa
tttgagatacttttttgtcatttttatgtaactaacacaataatctcgtacattattaaa
attttctatatgatagggataaagtaaagagcgaatgtgctgtaaaagtttttccaaggt
gatattacataaaggtataaagggtaaa


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0004029       F:aldehyde dehydrogenase (NAD) activity
GO:0016491       F:oxidoreductase activity
GO:0055114       P:oxidation reduction
cmr|NT01SA0171 Staphylococcus aureus N315     aldehyde dehydrogenase
cmr|NT02SA0164 Staphylococcus aureus Mu50     aldehyde dehydrogenase
cmr|NT03SA0156 Staphylococcus aureus MW2     aldehyde dehydrogenase homologue
dbj|BAB41382.1 Staphylococcus aureus subsp. aureus N315     aldA
dbj|BAB56329.1 Staphylococcus aureus subsp. aureus Mu50     aldehyde dehydrogenase homologue
dbj|BAB94007.1 Staphylococcus aureus subsp. aureus MW2     aldA
dbj|BAF77049.1 Staphylococcus aureus subsp. aureus Mu3     aldehyde dehydrogenase homologue
fig|158878.1.peg.167 Staphylococcus aureus subsp. aureus Mu50 FIG   Aldehyde dehydrogenase B (EC 1.2.1.22)
fig|158878.14.peg.165 Staphylococcus aureus subsp. aureus Mu50 FIG   Aldehyde dehydrogenase B (EC 1.2.1.22)
fig|158879.1.peg.165 Staphylococcus aureus subsp. aureus N315 FIG   Aldehyde dehydrogenase B (EC 1.2.1.22)
fig|196620.1.peg.142 Staphylococcus aureus subsp. aureus MW2 FIG   Aldehyde dehydrogenase B (EC 1.2.1.22)
fig|196620.5.peg.154 Staphylococcus aureus subsp. aureus MW2 FIG   Aldehyde dehydrogenase B (EC 1.2.1.22)
fig|359786.13.peg.193 Staphylococcus aureus subsp. aureus JH9 FIG   Aldehyde dehydrogenase B (EC 1.2.1.22)
fig|359786.3.peg.1126 Staphylococcus aureus subsp. aureus JH9 FIG   Aldehyde dehydrogenase B (EC 1.2.1.22)
fig|359787.11.peg.190 Staphylococcus aureus subsp. aureus JH1 FIG   Aldehyde dehydrogenase B (EC 1.2.1.22)
fig|359787.3.peg.1983 Staphylococcus aureus subsp. aureus JH1 FIG   Aldehyde dehydrogenase B (EC 1.2.1.22)
fig|418127.4.peg.149 Staphylococcus aureus subsp. aureus Mu3 FIG   Aldehyde dehydrogenase B (EC 1.2.1.22)
fig|418127.6.peg.164 Staphylococcus aureus subsp. aureus Mu3 FIG   Aldehyde dehydrogenase B (EC 1.2.1.22)
fig|450394.6.peg.1927 Staphylococcus aureus subsp. aureus USA300_TCH959 FIG   Aldehyde dehydrogenase B (EC 1.2.1.22)
fig|505321.3.peg.1834 Staphylococcus aureus subsp. aureus str. CF-Marseille FIG   Aldehyde dehydrogenase B (EC 1.2.1.22)
fig|548475.3.peg.2250 Staphylococcus aureus subsp. aureus TCH70 FIG   Aldehyde dehydrogenase B (EC 1.2.1.22)
fig|553565.3.peg.2485 Staphylococcus aureus A5937 FIG   Aldehyde dehydrogenase B (EC 1.2.1.22)
fig|553568.3.peg.800 Staphylococcus aureus A6224 FIG   Aldehyde dehydrogenase B (EC 1.2.1.22)
fig|553571.3.peg.2070 Staphylococcus aureus A6300 FIG   Aldehyde dehydrogenase B (EC 1.2.1.22)
fig|553573.3.peg.1961 Staphylococcus aureus A8115 FIG   Aldehyde dehydrogenase B (EC 1.2.1.22)
fig|553574.3.peg.1726 Staphylococcus aureus A8117 FIG   Aldehyde dehydrogenase B (EC 1.2.1.22)
fig|553577.3.peg.841 Staphylococcus aureus A8796 FIG   Aldehyde dehydrogenase B (EC 1.2.1.22)
fig|553580.3.peg.577 Staphylococcus aureus A8819 FIG   Aldehyde dehydrogenase B (EC 1.2.1.22)
fig|553581.3.peg.2092 Staphylococcus aureus A9299 FIG   Aldehyde dehydrogenase B (EC 1.2.1.22)
fig|553588.3.peg.1478 Staphylococcus aureus A9719 FIG   Aldehyde dehydrogenase B (EC 1.2.1.22)
fig|553592.3.peg.855 Staphylococcus aureus A9763 FIG   Aldehyde dehydrogenase B (EC 1.2.1.22)
fig|553596.3.peg.894 Staphylococcus aureus A9781 FIG   Aldehyde dehydrogenase B (EC 1.2.1.22)
fig|585891.3.peg.165 Staphylococcus aureus subsp. aureus Mu50-omega FIG   Aldehyde dehydrogenase B (EC 1.2.1.22)
fig|680649.3.peg.1639 Staphylococcus aureus subsp. aureus MR1 FIG   Aldehyde dehydrogenase B (EC 1.2.1.22)
fig|681288.4.peg.134 Staphylococcus aureus subsp. aureus ED98 FIG   Aldehyde dehydrogenase B (EC 1.2.1.22)
fig|703339.3.peg.168 Staphylococcus aureus 04-02981 FIG   Aldehyde dehydrogenase B (EC 1.2.1.22)
fig|762962.3.peg.1662 Staphylococcus aureus subsp. aureus ATCC 51811 FIG   Aldehyde dehydrogenase B (EC 1.2.1.22)
gb|ABQ47960.1 Staphylococcus aureus subsp. aureus JH9     aldehyde dehydrogenase
gb|ABR51020.1 Staphylococcus aureus subsp. aureus JH1     aldehyde dehydrogenase
gb|EES56441.1 Staphylococcus aureus subsp. aureus TCH70     aldehyde dehydrogenase family protein
gb|EES94499.1 Staphylococcus aureus subsp. aureus USA300_TCH959     aldehyde dehydrogenase family protein
gb|EEV26330.1 Staphylococcus aureus A9781     aldehyde dehydrogenase
gb|EEV65042.1 Staphylococcus aureus A9763     aldehyde dehydrogenase
gb|EEV67010.1 Staphylococcus aureus A9719     aldehyde dehydrogenase aldA
gb|EEV71786.1 Staphylococcus aureus A9299     aldehyde dehydrogenase
gb|EEV74356.1 Staphylococcus aureus A8115     aldehyde dehydrogenase
gb|EEV76994.1 Staphylococcus aureus A6300     aldehyde dehydrogenase
gb|EEV81005.1 Staphylococcus aureus A6224     aldehyde dehydrogenase
gb|EEV84704.1 Staphylococcus aureus A5937     aldehyde dehydrogenase aldA
gi|13700083 Staphylococcus aureus subsp. aureus N315 NCBI   aldA
gi|14245934 Staphylococcus aureus subsp. aureus Mu50 NCBI   aldehyde dehydrogenase homologue
gi|147739662 Staphylococcus aureus subsp. aureus JH9 NCBI   aldehyde dehydrogenase
gi|148266593 Staphylococcus aureus subsp. aureus JH9 NCBI   aldehyde dehydrogenase
gi|149945084 Staphylococcus aureus subsp. aureus JH1 NCBI   aldehyde dehydrogenase
gi|150392632 Staphylococcus aureus subsp. aureus JH1 NCBI   aldehyde dehydrogenase
gi|156720632 Staphylococcus aureus subsp. aureus Mu3 NCBI   aldehyde dehydrogenase homologue
gi|156978497 Staphylococcus aureus subsp. aureus Mu3 NCBI   aldehyde dehydrogenase homologue
gi|15923157 Staphylococcus aureus subsp. aureus Mu50 NCBI   aldehyde dehydrogenase-like protein
gi|15925871 Staphylococcus aureus subsp. aureus N315 NCBI   hypothetical protein SA0162
gi|21203306 Staphylococcus aureus subsp. aureus MW2 NCBI   aldA
gi|21281871 Staphylococcus aureus subsp. aureus MW2 NCBI   hypothetical protein MW0142
gi|251803784 Staphylococcus aureus subsp. aureus TCH70 NCBI   aldehyde dehydrogenase family protein
gi|251812676 Staphylococcus aureus subsp. aureus TCH70 NCBI   aldehyde dehydrogenase family protein
gi|253316301 Staphylococcus aureus subsp. aureus str. CF-Marseille NCBI   hypothetical protein SauraC_09206
gi|253725770 Staphylococcus aureus subsp. aureus USA300_TCH959 NCBI   aldehyde dehydrogenase family protein
gi|253730521 Staphylococcus aureus subsp. aureus USA300_TCH959 NCBI   aldehyde dehydrogenase family protein
gi|255004964 Staphylococcus aureus subsp. aureus Mu50-omega NCBI   hypothetical protein SauraM_00805
gi|257787990 Staphylococcus aureus A9781 NCBI   aldehyde dehydrogenase
gi|257794018 Staphylococcus aureus A9781 NCBI   aldehyde dehydrogenase
gi|257840583 Staphylococcus aureus A9763 NCBI   aldehyde dehydrogenase
gi|257842588 Staphylococcus aureus A9719 NCBI   aldehyde dehydrogenase aldA
gi|257847790 Staphylococcus aureus A9299 NCBI   aldehyde dehydrogenase
gi|257850408 Staphylococcus aureus A8115 NCBI   aldehyde dehydrogenase
gi|257854041 Staphylococcus aureus A6300 NCBI   aldehyde dehydrogenase
gi|257858117 Staphylococcus aureus A6224 NCBI   aldehyde dehydrogenase
gi|257861931 Staphylococcus aureus A5937 NCBI   aldehyde dehydrogenase aldA
gi|258408574 Staphylococcus aureus A9763 NCBI   aldehyde dehydrogenase
gi|258421164 Staphylococcus aureus A9719 NCBI   aldehyde dehydrogenase aldA
gi|258438914 Staphylococcus aureus A9299 NCBI   aldehyde dehydrogenase
gi|258444149 Staphylococcus aureus A8115 NCBI   aldehyde dehydrogenase
gi|258447028 Staphylococcus aureus A6300 NCBI   aldehyde dehydrogenase
gi|258448486 Staphylococcus aureus A6224 NCBI   aldehyde dehydrogenase
gi|258455719 Staphylococcus aureus A5937 NCBI   aldehyde dehydrogenase aldA
gi|81704742 organism not parsed/found in ncbi nr NCBI   RecName: Full=Putative aldehyde dehydrogenase aldA
gi|81706407 organism not parsed/found in ncbi nr NCBI   RecName: Full=Putative aldehyde dehydrogenase aldA
gi|81782331 organism not parsed/found in ncbi nr NCBI   RecName: Full=Putative aldehyde dehydrogenase aldA
img|637091762 Staphylococcus aureus aureus N315 IMG   hypothetical protein( EC:1.2.1.8 )
img|637098666 Staphylococcus aureus aureus Mu50 IMG   aldehyde dehydrogenase homolog( EC:1.2.1.8 )
img|637297882 Staphylococcus aureus aureus MW2 IMG   hypothetical protein( EC:1.2.1.8 )
img|639108487 Staphylococcus aureus aureus JH1 IMG   Aldehyde dehydrogenase( EC:1.2.1.8 )
img|640564483 Staphylococcus aureus aureus JH9 IMG   aldehyde dehydrogenase
img|640778228 Staphylococcus aureus aureus JH1 IMG   aldehyde dehydrogenase( EC:1.2.1.8 )
img|640902888 Staphylococcus aureus aureus Mu3 IMG   aldehyde dehydrogenase homologue( EC:1.2.1.8 )
kegg|sah:SaurJH1_0158 Staphylococcus aureus subsp. aureus JH1 KEGG   aldehyde dehydrogenase
kegg|saj:SaurJH9_0153 Staphylococcus aureus subsp. aureus JH9 KEGG   aldehyde dehydrogenase
kegg|sam:MW0142 Staphylococcus aureus subsp. aureus MW2 KEGG   hypothetical protein
kegg|sau:SA0162   KEGG   hypothetical protein
kegg|sav:SAV0167   KEGG   aldehyde dehydrogenase-like protein
kegg|saw:SAHV_0166 Staphylococcus aureus subsp. aureus Mu3 KEGG   aldehyde dehydrogenase homologue
ref|NP_370691.1 Staphylococcus aureus subsp. aureus Mu50 RefSeq   aldehyde dehydrogenase-like protein
ref|NP_373404.1 Staphylococcus aureus subsp. aureus N315 RefSeq   hypothetical protein SA0162
ref|NP_644957.1 Staphylococcus aureus subsp. aureus MW2 RefSeq   hypothetical protein MW0142
ref|YP_001245536.1 Staphylococcus aureus subsp. aureus JH9 RefSeq   aldehyde dehydrogenase
ref|YP_001315307.1 Staphylococcus aureus subsp. aureus JH1 RefSeq   aldehyde dehydrogenase
ref|YP_001440756.1 Staphylococcus aureus subsp. aureus Mu3 RefSeq   aldehyde dehydrogenase homologue
ref|ZP_04827149.1 Staphylococcus aureus subsp. aureus TCH70 RefSeq   aldehyde dehydrogenase family protein
ref|ZP_04839514.1 Staphylococcus aureus subsp. aureus str. CF-Marseille RefSeq   hypothetical protein SauraC_09206
ref|ZP_04864686.1 Staphylococcus aureus subsp. aureus USA300_TCH959 RefSeq   aldehyde dehydrogenase family protein
ref|ZP_05143565.2 Staphylococcus aureus subsp. aureus Mu50-omega RefSeq   hypothetical protein SauraM_00805
ref|ZP_05642997.1 Staphylococcus aureus A9781 RefSeq   aldehyde dehydrogenase
ref|ZP_05680859.1 Staphylococcus aureus A9763 RefSeq   aldehyde dehydrogenase
ref|ZP_05684091.1 Staphylococcus aureus A9719 RefSeq   aldehyde dehydrogenase aldA
ref|ZP_05690005.1 Staphylococcus aureus A9299 RefSeq   aldehyde dehydrogenase
ref|ZP_05692483.1 Staphylococcus aureus A8115 RefSeq   aldehyde dehydrogenase
ref|ZP_05695178.1 Staphylococcus aureus A6300 RefSeq   aldehyde dehydrogenase
ref|ZP_05696599.1 Staphylococcus aureus A6224 RefSeq   aldehyde dehydrogenase
ref|ZP_05703674.1 Staphylococcus aureus A5937 RefSeq   aldehyde dehydrogenase aldA
sp|ALDA_STAAM organism not parsed/found in ncbi nr SwissProt   RecName: Full=Putative aldehyde dehydrogenase aldA
sp|ALDA_STAAN organism not parsed/found in ncbi nr SwissProt   RecName: Full=Putative aldehyde dehydrogenase aldA
sp|ALDA_STAAW organism not parsed/found in ncbi nr SwissProt   RecName: Full=Putative aldehyde dehydrogenase aldA
sp|Q7A1Y7 Staphylococcus aureus (strain MW2) SwissProt   Putative aldehyde dehydrogenase aldA
sp|Q7A825 Staphylococcus aureus (strain N315) SwissProt   Putative aldehyde dehydrogenase aldA
sp|Q99X54 Staphylococcus aureus (strain Mu50 / ATCC 700699) SwissProt   Putative aldehyde dehydrogenase aldA
tr|A5IP37 Staphylococcus aureus (strain JH9) TrEMBL   Aldehyde dehydrogenase
tr|A6TXV2 Staphylococcus aureus (strain JH1) TrEMBL   Aldehyde dehydrogenase
tr|A7WXE8 Staphylococcus aureus (strain Mu3 / ATCC 700698) TrEMBL   Aldehyde dehydrogenase homologue
tr|C5N144 Staphylococcus aureus subsp. aureus USA300_TCH959 TrEMBL   Aldehyde dehydrogenase family protein
tr|C5QED3 Staphylococcus aureus subsp. aureus TCH70 TrEMBL   Aldehyde dehydrogenase family protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search