The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|158879.11.peg.165: Staphylococcus aureus subsp. aureus N315

This feature in The SEED Viewer

NCBI Taxonomy Id: 158879

Current Assignment: Heme-degrading monooxygenase, staphylobilin-producing (EC 1.14.99.48) # IsdI
Translate Function Assignments



Context on contig NC_002745 from base 178779 to 189467 (10689 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
160 178779 179984 1206 +           Capsular polysaccharide synthesis enzyme CapL gene_name|capL, locus|SA0155, protein_id|NP_373397.1, gi|15925864, geneID|1122930
161 179995 180552 558 + 10         Capsular polysaccharide synthesis enzyme CapM gene_name|capM, locus|SA0156, protein_id|NP_373398.1, gi|15925865, geneID|1122931
162 180552 181439 888 + -1         Capsular polysaccharide synthesis enzyme CapN gene_name|capN, locus|SA0157, protein_id|NP_373399.1, gi|15925866, geneID|1122932
163 181493 182755 1263 + 53       dlit(21454499) UDP-N-acetyl-D-mannosamine dehydrogenase (EC 1.1.1.336) gene_name|capO, locus|SA0158, protein_id|NP_373400.1, gi|15925867, geneID|1122933
164 182832 183977 1146 + 76         Capsular polysaccharide synthesis enzyme Cap8P gene_name|capP, locus|SA0159, protein_id|NP_373401.1, gi|15925868, geneID|1122934
165 184368 184042 327 - 64     1: 1 dlit(14570922)
dlit(15520015)
Heme-degrading monooxygenase, staphylobilin-producing (EC 1.14.99.48) # IsdI locus|SA0160, protein_id|NP_373402.1, gi|15925869, geneID|1122935
166 184758 184375 384 - 6     1: 1   Inner membrane protein YbaN locus|SA0161, protein_id|NP_373403.1, gi|15925870, geneID|1122936
167 185185 186672 1488 + 426     3: 2 5 6   Aldehyde dehydrogenase B (EC 1.2.1.22) gene_name|aldA, locus|SA0162, protein_id|NP_373404.1, gi|15925871, geneID|1122937
168 187319 188278 960 + 646     3: 3 7 4   Cobalt-zinc-cadmium resistance protein locus|SA0163, protein_id|NP_373405.1, gi|15925872, geneID|1122938
169 188407 188270 138 - -9         hypothetical protein  
170 188346 188525 180 + -62         hypothetical protein  
171 188543 188388 156 - -138         hypothetical protein locus|SAS005, protein_id|NP_373406.1, gi|15925873, geneID|1122939
172 188438 188590 153 + -106         hypothetical protein  
173 188776 188573 204 - -18         FIG01108246: hypothetical protein locus|SA0164, protein_id|NP_373407.1, gi|15925874, geneID|1122940
174 188955 189467 513 + 178         FIG01108032: hypothetical protein locus|SA0165, protein_id|NP_373408.1, gi|15925875, geneID|1122941

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
Heme,_hemin_uptake_and_utilization_systems_in_GramPositives SvetaG Heme-degrading cytoplasmic oxygenase IsdI


  Protein Sequence

>fig|158879.11.peg.165 Heme-degrading monooxygenase, staphylobilin-producing (EC 1.14.99.48) # IsdI
MFMAENRLQLQKGSAEETIERFYNRQGIETIEGFQQMFVTKTLNTEDTDEVKILTIWESE
DSFNNWLNSDVFKEAHKNVRLKSDDDGQQSPILSNKVFKYDIGYHYQK

MD5 = 49ab0dcea842a5d4e382c62b892e9913


  DNA Sequence

>fig|158879.11.peg.165 Heme-degrading monooxygenase, staphylobilin-producing (EC 1.14.99.48) # IsdI
atgtttatggcagaaaatagattacaattacaaaaaggcagtgcggaagaaacgattgaa
cgtttttacaatagacaaggcattgaaactattgaaggcttccaacaaatgtttgtcact
aaaacattaaataccgaggatacagacgaagttaaaatcttaactatttgggaatctgaa
gatagctttaataattggttgaattccgatgtatttaaagaagctcataaaaatgtacgt
ttaaaaagtgatgacgatggacagcaaagtccaatattatcaaataaagtattcaaatat
gatattggctaccactatcaaaaataa


  DNA with Flanking Sequence

>fig|158879.11.peg.165 Heme-degrading monooxygenase, staphylobilin-producing (EC 1.14.99.48) # IsdI
acgtttcattttactgagtcattgcacttatcatacacattatatttagcatgagttata
ttactaaaacaatattacatgcgcattagtactagaatggagttttttcaatgcgactta
ttttaatcgttattggcttaatatttacagcgcttggtattgcaggtgccgtattacctt
tactgccaacgaccccttttttactcgtagcagttttttgttttgctcgaagttcagatc
ggttttacaattggcttattaatcaaaaaatttataaagaatatgtagaaaacttttatt
tacatcgaggctacacgctacaacagaaaattaaaattttaattagcttatacattgtaa
taggtttttcaatttatatggtggatgttcttgcagtccgtgtaggattaatcataatgg
ttatcatacaaaccgctgtactctttacatttgtaaaaacattacccaaatcaaatcata
aaatagaggagtgattgcccatgtttatggcagaaaatagattacaattacaaaaaggca
gtgcggaagaaacgattgaacgtttttacaatagacaaggcattgaaactattgaaggct
tccaacaaatgtttgtcactaaaacattaaataccgaggatacagacgaagttaaaatct
taactatttgggaatctgaagatagctttaataattggttgaattccgatgtatttaaag
aagctcataaaaatgtacgtttaaaaagtgatgacgatggacagcaaagtccaatattat
caaataaagtattcaaatatgatattggctaccactatcaaaaataaatatattaaaaac
ccctagtcaccgctggttgtctaaaccaacttcatgattaggggttttttattatttgtg
acgtaaaggtacgaattcatccggcttgtctgagcgcaatccaaaataatattctattgc
ttcacaaatacgtcgtgatgcttgtccatcaccatatggattattcgcttgactcatacg
ttgatacgcttcatcatcctcaatcaattgtttcacatttcgaacaatattgtcataatc
tgtgccaattactctcgatgttcccgcctcaacgccttcgggacgctctgtatgattcct
taataccaacacaggttttccaaatgtaggagcctcctcttgaataccaccagaatctgt
cagcacgaggtacgattgatttgtaaaattatggaactcaatcgcatctaatggctcaat
taattcaatccgatttctcccagataaatatttttcggcaatcgctcttacctttggatt
acgatgc


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0004392       F:heme oxygenase (decyclizing) activity
GO:0004497       F:monooxygenase activity
GO:0005737       C:cytoplasm
GO:0016491       F:oxidoreductase activity
GO:0017000       P:antibiotic biosynthetic process
GO:0020037       F:heme binding
GO:0055114       P:oxidation reduction
cmr|NT01SA0169 Staphylococcus aureus N315     conserved hypothetical protein
cmr|NT02SA0162 Staphylococcus aureus Mu50     Signal transduction protein TRAP
cmr|NT03SA0154 Staphylococcus aureus MW2     conserved hypothetical protein
cmr|NT05SA0117 Staphylococcus aureus NCTC 8325     antibiotic biosynthesis monooxygenase
cmr|NT09SA0139 Staphylococcus aureus subsp. aureus MSSA476     Signal transduction protein TRAP
cmr|SACOL0152 Staphylococcus aureus subsp. aureus COL     conserved hypothetical protein
cmr|SAUSA300_0168 Staphylococcus aureus subsp. aureus USA300-FPR3757     conserved hypothetical protein
dbj|BAB41380.1 Staphylococcus aureus subsp. aureus N315     conserved hypothetical protein
dbj|BAB56327.1 Staphylococcus aureus subsp. aureus Mu50     conserved hypothetical protein
dbj|BAB94005.1 Staphylococcus aureus subsp. aureus MW2     conserved hypothetical protein
dbj|BAF66383.1 Staphylococcus aureus subsp. aureus str. Newman     conserved hypothetical protein
dbj|BAF77047.1 Staphylococcus aureus subsp. aureus Mu3     conserved hypothetical protein
emb|CAG41908.1 Staphylococcus aureus subsp. aureus MSSA476 EMBL   conserved hypothetical protein
fig|158878.1.peg.165 Staphylococcus aureus subsp. aureus Mu50 FIG   Heme-degrading monooxygenase, staphylobilin-producing (EC 1.14.99.48) # IsdI
fig|158878.14.peg.163 Staphylococcus aureus subsp. aureus Mu50 FIG   Heme-degrading monooxygenase, staphylobilin-producing (EC 1.14.99.48) # IsdI
fig|158879.1.peg.163 Staphylococcus aureus subsp. aureus N315 FIG   Heme-degrading monooxygenase, staphylobilin-producing (EC 1.14.99.48) # IsdI
fig|196620.1.peg.140 Staphylococcus aureus subsp. aureus MW2 FIG   Heme-degrading monooxygenase, staphylobilin-producing (EC 1.14.99.48) # IsdI
fig|196620.5.peg.152 Staphylococcus aureus subsp. aureus MW2 FIG   Heme-degrading monooxygenase, staphylobilin-producing (EC 1.14.99.48) # IsdI
fig|282459.1.peg.129 Staphylococcus aureus subsp. aureus MSSA476 FIG   Heme-degrading monooxygenase, staphylobilin-producing (EC 1.14.99.48) # IsdI
fig|282459.5.peg.150 Staphylococcus aureus subsp. aureus MSSA476 FIG   Heme-degrading monooxygenase, staphylobilin-producing (EC 1.14.99.48) # IsdI
fig|359786.13.peg.191 Staphylococcus aureus subsp. aureus JH9 FIG   Heme-degrading monooxygenase, staphylobilin-producing (EC 1.14.99.48) # IsdI
fig|359786.3.peg.1128 Staphylococcus aureus subsp. aureus JH9 FIG   Heme-degrading monooxygenase, staphylobilin-producing (EC 1.14.99.48) # IsdI
fig|359787.11.peg.188 Staphylococcus aureus subsp. aureus JH1 FIG   Heme-degrading monooxygenase, staphylobilin-producing (EC 1.14.99.48) # IsdI
fig|359787.3.peg.1984 Staphylococcus aureus subsp. aureus JH1 FIG   Heme-degrading monooxygenase, staphylobilin-producing (EC 1.14.99.48) # IsdI
fig|367830.3.peg.1458 Staphylococcus aureus subsp. aureus USA300 FIG   Heme-degrading monooxygenase, staphylobilin-producing (EC 1.14.99.48) # IsdI
fig|418127.4.peg.148 Staphylococcus aureus subsp. aureus Mu3 FIG   Heme-degrading monooxygenase, staphylobilin-producing (EC 1.14.99.48) # IsdI
fig|418127.6.peg.162 Staphylococcus aureus subsp. aureus Mu3 FIG   Heme-degrading monooxygenase, staphylobilin-producing (EC 1.14.99.48) # IsdI
fig|426430.6.peg.112 Staphylococcus aureus subsp. aureus str. Newman FIG   Heme-degrading monooxygenase, staphylobilin-producing (EC 1.14.99.48) # IsdI
fig|426430.8.peg.120 Staphylococcus aureus subsp. aureus str. Newman FIG   Heme-degrading monooxygenase, staphylobilin-producing (EC 1.14.99.48) # IsdI
fig|450394.6.peg.1925 Staphylococcus aureus subsp. aureus USA300_TCH959 FIG   Heme-degrading monooxygenase, staphylobilin-producing (EC 1.14.99.48) # IsdI
fig|451515.3.peg.227 Staphylococcus aureus subsp. aureus USA300_FPR3757 FIG   Heme-degrading monooxygenase, staphylobilin-producing (EC 1.14.99.48) # IsdI
fig|451516.9.peg.216 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   Heme-degrading monooxygenase, staphylobilin-producing (EC 1.14.99.48) # IsdI
fig|452948.4.peg.18 Staphylococcus aureus 930918-3 FIG   Heme-degrading monooxygenase, staphylobilin-producing (EC 1.14.99.48) # IsdI
fig|455227.3.peg.181 Staphylococcus aureus D30 FIG   Heme-degrading monooxygenase, staphylobilin-producing (EC 1.14.99.48) # IsdI
fig|505321.3.peg.1836 Staphylococcus aureus subsp. aureus str. CF-Marseille FIG   Heme-degrading monooxygenase, staphylobilin-producing (EC 1.14.99.48) # IsdI
fig|548474.3.peg.4 Staphylococcus aureus subsp. aureus TCH130 FIG   Heme-degrading monooxygenase, staphylobilin-producing (EC 1.14.99.48) # IsdI
fig|548475.3.peg.2252 Staphylococcus aureus subsp. aureus TCH70 FIG   Heme-degrading monooxygenase, staphylobilin-producing (EC 1.14.99.48) # IsdI
fig|553565.3.peg.2483 Staphylococcus aureus A5937 FIG   Heme-degrading monooxygenase, staphylobilin-producing (EC 1.14.99.48) # IsdI
fig|553567.3.peg.1092 Staphylococcus aureus A5948 FIG   Heme-degrading monooxygenase, staphylobilin-producing (EC 1.14.99.48) # IsdI
fig|553568.3.peg.798 Staphylococcus aureus A6224 FIG   Heme-degrading monooxygenase, staphylobilin-producing (EC 1.14.99.48) # IsdI
fig|553571.3.peg.2068 Staphylococcus aureus A6300 FIG   Heme-degrading monooxygenase, staphylobilin-producing (EC 1.14.99.48) # IsdI
fig|553573.3.peg.1959 Staphylococcus aureus A8115 FIG   Heme-degrading monooxygenase, staphylobilin-producing (EC 1.14.99.48) # IsdI
fig|553574.3.peg.1724 Staphylococcus aureus A8117 FIG   Heme-degrading monooxygenase, staphylobilin-producing (EC 1.14.99.48) # IsdI
fig|553577.3.peg.839 Staphylococcus aureus A8796 FIG   Heme-degrading monooxygenase, staphylobilin-producing (EC 1.14.99.48) # IsdI
fig|553580.3.peg.575 Staphylococcus aureus A8819 FIG   Heme-degrading monooxygenase, staphylobilin-producing (EC 1.14.99.48) # IsdI
fig|553581.3.peg.2090 Staphylococcus aureus A9299 FIG   Heme-degrading monooxygenase, staphylobilin-producing (EC 1.14.99.48) # IsdI
fig|553588.3.peg.1476 Staphylococcus aureus A9719 FIG   Heme-degrading monooxygenase, staphylobilin-producing (EC 1.14.99.48) # IsdI
fig|553590.4.peg.1170 Staphylococcus aureus A9754 FIG   Heme-degrading monooxygenase, staphylobilin-producing (EC 1.14.99.48) # IsdI
fig|553592.3.peg.853 Staphylococcus aureus A9763 FIG   Heme-degrading monooxygenase, staphylobilin-producing (EC 1.14.99.48) # IsdI
fig|553594.3.peg.829 Staphylococcus aureus A9765 FIG   Heme-degrading monooxygenase, staphylobilin-producing (EC 1.14.99.48) # IsdI
fig|553596.3.peg.896 Staphylococcus aureus A9781 FIG   Heme-degrading monooxygenase, staphylobilin-producing (EC 1.14.99.48) # IsdI
fig|553601.3.peg.28 Staphylococcus aureus A10102 FIG   Heme-degrading monooxygenase, staphylobilin-producing (EC 1.14.99.48) # IsdI
fig|585891.3.peg.163 Staphylococcus aureus subsp. aureus Mu50-omega FIG   Heme-degrading monooxygenase, staphylobilin-producing (EC 1.14.99.48) # IsdI
fig|644279.4.peg.237 Staphylococcus aureus subsp. aureus 132 FIG   Heme-degrading monooxygenase, staphylobilin-producing (EC 1.14.99.48) # IsdI
fig|680649.3.peg.1637 Staphylococcus aureus subsp. aureus MR1 FIG   Heme-degrading monooxygenase, staphylobilin-producing (EC 1.14.99.48) # IsdI
fig|703339.3.peg.166 Staphylococcus aureus 04-02981 FIG   Heme-degrading monooxygenase, staphylobilin-producing (EC 1.14.99.48) # IsdI
fig|762962.3.peg.1664 Staphylococcus aureus subsp. aureus ATCC 51811 FIG   Heme-degrading monooxygenase, staphylobilin-producing (EC 1.14.99.48) # IsdI
fig|93061.3.peg.143 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Heme-degrading monooxygenase, staphylobilin-producing (EC 1.14.99.48) # IsdI
fig|93061.5.peg.122 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Heme-degrading monooxygenase, staphylobilin-producing (EC 1.14.99.48) # IsdI
fig|93062.19.peg.150 Staphylococcus aureus subsp. aureus COL FIG   Heme-degrading monooxygenase, staphylobilin-producing (EC 1.14.99.48) # IsdI
fig|93062.4.peg.619 Staphylococcus aureus subsp. aureus COL FIG   Heme-degrading monooxygenase, staphylobilin-producing (EC 1.14.99.48) # IsdI
gb|AAW37449.1 Staphylococcus aureus subsp. aureus COL     conserved hypothetical protein
gb|ABD22465.1 Staphylococcus aureus subsp. aureus USA300_FPR3757     conserved hypothetical protein
gb|ABD29311.1 Staphylococcus aureus subsp. aureus NCTC 8325     conserved hypothetical protein
gb|ABQ47958.1 Staphylococcus aureus subsp. aureus JH9     Antibiotic biosynthesis monooxygenase
gb|ABR51018.1 Staphylococcus aureus subsp. aureus JH1     Antibiotic biosynthesis monooxygenase
gb|EES94497.1 Staphylococcus aureus subsp. aureus USA300_TCH959     heme oxygenase
gb|EEV26332.1 Staphylococcus aureus A9781     heme-degrading monooxygenase IsdI
gb|EEV65040.1 Staphylococcus aureus A9763     heme-degrading monooxygenase isdI
gb|EEV67008.1 Staphylococcus aureus A9719     heme-degrading monooxygenase isdI
gb|EEV71784.1 Staphylococcus aureus A9299     heme-degrading monooxygenase isdI
gb|EEV74354.1 Staphylococcus aureus A8115     heme-degrading monooxygenase isdG
gb|EEV76992.1 Staphylococcus aureus A6300     heme-degrading monooxygenase isdI
gb|EEV81003.1 Staphylococcus aureus A6224     heme-degrading monooxygenase isdI
gb|EEV83473.1 Staphylococcus aureus A5948     heme-degrading monooxygenase isdI
gb|EEV84702.1 Staphylococcus aureus A5937     heme-degrading monooxygenase isdI
gb|EEW46037.1 Staphylococcus aureus 930918-3     hypothetical protein SA930_0696
gb|EEW48124.1 Staphylococcus aureus D30     hypothetical protein SAD30_1679
gi|122064268 organism not parsed/found in ncbi nr NCBI   RecName: Full=Heme-degrading monooxygenase isdI; AltName: Full=Iron-regulated surface determinant isdI; AltName: Full=Iron-responsive surface determinant isdI; AltName: Full=Heme oxygenase
gi|122064269 organism not parsed/found in ncbi nr NCBI   RecName: Full=Heme-degrading monooxygenase isdI; AltName: Full=Iron-regulated surface determinant isdI; AltName: Full=Iron-responsive surface determinant isdI; AltName: Full=Heme oxygenase
gi|13700081 Staphylococcus aureus subsp. aureus N315 NCBI   conserved hypothetical protein
gi|14245932 Staphylococcus aureus subsp. aureus Mu50 NCBI   conserved hypothetical protein
gi|147739660 Staphylococcus aureus subsp. aureus JH9 NCBI   Antibiotic biosynthesis monooxygenase
gi|148266591 Staphylococcus aureus subsp. aureus JH9 NCBI   heme-degrading monooxygenase IsdI
gi|149945082 Staphylococcus aureus subsp. aureus JH1 NCBI   Antibiotic biosynthesis monooxygenase
gi|150373123 Staphylococcus aureus subsp. aureus str. Newman NCBI   conserved hypothetical protein
gi|150392630 Staphylococcus aureus subsp. aureus JH1 NCBI   heme-degrading monooxygenase IsdI
gi|151220323 Staphylococcus aureus subsp. aureus str. Newman NCBI   heme-degrading monooxygenase IsdI
gi|156720630 Staphylococcus aureus subsp. aureus Mu3 NCBI   conserved hypothetical protein
gi|156978495 Staphylococcus aureus subsp. aureus Mu3 NCBI   heme-degrading monooxygenase IsdI
gi|15923155 Staphylococcus aureus subsp. aureus Mu50 NCBI   heme-degrading monooxygenase IsdI
gi|15925869 Staphylococcus aureus subsp. aureus N315 NCBI   heme-degrading monooxygenase IsdI
gi|166973729 organism not parsed/found in ncbi nr NCBI   RecName: Full=Heme-degrading monooxygenase isdG; AltName: Full=Iron-regulated surface determinant isdG; AltName: Full=Iron-responsive surface determinant isdG; AltName: Full=Heme oxygenase
gi|21203304 Staphylococcus aureus subsp. aureus MW2 NCBI   conserved hypothetical protein
gi|21281869 Staphylococcus aureus subsp. aureus MW2 NCBI   heme-degrading monooxygenase IsdI
gi|253316303 Staphylococcus aureus subsp. aureus str. CF-Marseille NCBI   heme-degrading monooxygenase IsdI
gi|253725768 Staphylococcus aureus subsp. aureus USA300_TCH959 NCBI   heme oxygenase
gi|253730519 Staphylococcus aureus subsp. aureus USA300_TCH959 NCBI   heme oxygenase
gi|255004962 Staphylococcus aureus subsp. aureus Mu50-omega NCBI   heme-degrading monooxygenase IsdI
gi|257787992 Staphylococcus aureus A9781 NCBI   heme-degrading monooxygenase IsdI
gi|257794020 Staphylococcus aureus A9781 NCBI   heme-degrading monooxygenase IsdI
gi|257840581 Staphylococcus aureus A9763 NCBI   heme-degrading monooxygenase isdI
gi|257842586 Staphylococcus aureus A9719 NCBI   heme-degrading monooxygenase isdI
gi|257847788 Staphylococcus aureus A9299 NCBI   heme-degrading monooxygenase isdI
gi|257850406 Staphylococcus aureus A8115 NCBI   heme-degrading monooxygenase isdG
gi|257854039 Staphylococcus aureus A6300 NCBI   heme-degrading monooxygenase isdI
gi|257858115 Staphylococcus aureus A6224 NCBI   heme-degrading monooxygenase isdI
gi|257860651 Staphylococcus aureus A5948 NCBI   heme-degrading monooxygenase isdI
gi|257861929 Staphylococcus aureus A5937 NCBI   heme-degrading monooxygenase isdI
gi|258408572 Staphylococcus aureus A9763 NCBI   heme-degrading monooxygenase isdI
gi|258421162 Staphylococcus aureus A9719 NCBI   heme-degrading monooxygenase isdI
gi|258438912 Staphylococcus aureus A9299 NCBI   heme-degrading monooxygenase isdI
gi|258444147 Staphylococcus aureus A8115 NCBI   heme-degrading monooxygenase isdG
gi|258447026 Staphylococcus aureus A6300 NCBI   heme-degrading monooxygenase isdI
gi|258448484 Staphylococcus aureus A6224 NCBI   heme-degrading monooxygenase isdI
gi|258451603 Staphylococcus aureus A5948 NCBI   heme-degrading monooxygenase isdI
gi|258455717 Staphylococcus aureus A5937 NCBI   heme-degrading monooxygenase isdI
gi|259161018 Staphylococcus aureus 930918-3 NCBI   hypothetical protein SA930_0696
gi|259163568 Staphylococcus aureus D30 NCBI   hypothetical protein SAD30_1679
gi|49243484 Staphylococcus aureus subsp. aureus MSSA476 NCBI   conserved hypothetical protein
gi|49485041 Staphylococcus aureus subsp. aureus MSSA476 NCBI   heme-degrading monooxygenase IsdI
gi|57285355 Staphylococcus aureus subsp. aureus COL NCBI   conserved hypothetical protein
gi|57651169 Staphylococcus aureus subsp. aureus COL NCBI   heme-degrading monooxygenase IsdI
gi|81650164 organism not parsed/found in ncbi nr NCBI   RecName: Full=Heme-degrading monooxygenase isdI; AltName: Full=Iron-regulated surface determinant isdI; AltName: Full=Iron-responsive surface determinant isdI; AltName: Full=Heme oxygenase
gi|81695506 organism not parsed/found in ncbi nr NCBI   RecName: Full=Heme-degrading monooxygenase isdI; AltName: Full=Iron-regulated surface determinant isdI; AltName: Full=Iron-responsive surface determinant isdI; AltName: Full=Heme oxygenase
gi|81704743 organism not parsed/found in ncbi nr NCBI   RecName: Full=Heme-degrading monooxygenase isdG; AltName: Full=Iron-regulated surface determinant isdG; AltName: Full=Iron-responsive surface determinant isdG; AltName: Full=Heme oxygenase
gi|81706409 organism not parsed/found in ncbi nr NCBI   RecName: Full=Heme-degrading monooxygenase isdI; AltName: Full=Iron-regulated surface determinant isdI; AltName: Full=Iron-responsive surface determinant isdI; AltName: Full=Heme oxygenase
gi|81782333 organism not parsed/found in ncbi nr NCBI   RecName: Full=Heme-degrading monooxygenase isdI; AltName: Full=Iron-regulated surface determinant isdI; AltName: Full=Iron-responsive surface determinant isdI; AltName: Full=Heme oxygenase
gi|87127951 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   conserved hypothetical protein
gi|87161977 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   heme-degrading monooxygenase IsdI
gi|87201501 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   conserved hypothetical protein
gi|88193943 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   heme-degrading monooxygenase IsdI
img|637091760 Staphylococcus aureus aureus N315 IMG   hypothetical protein
img|637098664 Staphylococcus aureus aureus Mu50 IMG   iron-regulated surface determinant I
img|637150935 Staphylococcus aureus aureus COL IMG   hypothetical protein
img|637156342 Staphylococcus aureus aureus MSSA476 IMG   hypothetical protein
img|637297880 Staphylococcus aureus aureus MW2 IMG   hypothetical protein
img|637886823 Staphylococcus aureus aureus USA300 IMG   hypothetical protein
img|637892804 Staphylococcus aureus aureus NCTC 8325 IMG   hypothetical protein
img|639108489 Staphylococcus aureus aureus JH1 IMG   Antibiotic biosynthesis monooxygenase
img|640564481 Staphylococcus aureus aureus JH9 IMG   Antibiotic biosynthesis monooxygenase
img|640778226 Staphylococcus aureus aureus JH1 IMG   Antibiotic biosynthesis monooxygenase
img|640794471 Staphylococcus aureus aureus Newman IMG   hypothetical protein
img|640902886 Staphylococcus aureus aureus Mu3 IMG   hypothetical protein
img|641771885 Staphylococcus aureus aureus USA300_TCH959 IMG   hypothetical protein
kegg|saa:SAUSA300_0168 Staphylococcus aureus subsp. aureus USA300_FPR3757 KEGG   heme-degrading monooxygenase IsdI (EC:1.14.99.3)
kegg|sac:SACOL0152 Staphylococcus aureus subsp. aureus COL KEGG   heme-degrading monooxygenase IsdI (EC:1.14.99.3)
kegg|sae:NWMN_0111 Staphylococcus aureus subsp. aureus Newman KEGG   heme-degrading monooxygenase IsdI (EC:1.14.99.3)
kegg|sah:SaurJH1_0156 Staphylococcus aureus subsp. aureus JH1 KEGG   heme-degrading monooxygenase IsdI (EC:1.14.99.3)
kegg|saj:SaurJH9_0151 Staphylococcus aureus subsp. aureus JH9 KEGG   heme-degrading monooxygenase IsdI (EC:1.14.99.3)
kegg|sam:MW0140 Staphylococcus aureus subsp. aureus MW2 KEGG   heme-degrading monooxygenase IsdI (EC:1.14.99.3)
kegg|sao:SAOUHSC_00130 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   heme-degrading monooxygenase IsdI (EC:1.14.99.3)
kegg|sas:SAS0140   KEGG   heme-degrading monooxygenase IsdI (EC:1.14.99.3)
kegg|sau:SA0160   KEGG   heme-degrading monooxygenase IsdI (EC:1.14.99.3)
kegg|sav:SAV0165   KEGG   heme-degrading monooxygenase IsdI (EC:1.14.99.3)
kegg|saw:SAHV_0164 Staphylococcus aureus subsp. aureus Mu3 KEGG   heme-degrading monooxygenase IsdI
ref|NP_370689.1 Staphylococcus aureus subsp. aureus Mu50 RefSeq   heme-degrading monooxygenase IsdI
ref|NP_373402.1 Staphylococcus aureus subsp. aureus N315 RefSeq   heme-degrading monooxygenase IsdI
ref|NP_644955.1 Staphylococcus aureus subsp. aureus MW2 RefSeq   heme-degrading monooxygenase IsdI
ref|YP_001245534.1 Staphylococcus aureus subsp. aureus JH9 RefSeq   heme-degrading monooxygenase IsdI
ref|YP_001315305.1 Staphylococcus aureus subsp. aureus JH1 RefSeq   heme-degrading monooxygenase IsdI
ref|YP_001331146.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   heme-degrading monooxygenase IsdI
ref|YP_001440754.1 Staphylococcus aureus subsp. aureus Mu3 RefSeq   heme-degrading monooxygenase IsdI
ref|YP_042262.1 Staphylococcus aureus subsp. aureus MSSA476 RefSeq   heme-degrading monooxygenase IsdI
ref|YP_185052.1 Staphylococcus aureus subsp. aureus COL RefSeq   heme-degrading monooxygenase IsdI
ref|YP_492882.1 Staphylococcus aureus subsp. aureus USA300_FPR3757 RefSeq   heme-degrading monooxygenase IsdI
ref|YP_498730.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   heme-degrading monooxygenase IsdI
ref|ZP_04839516.1 Staphylococcus aureus subsp. aureus str. CF-Marseille RefSeq   heme-degrading monooxygenase IsdI
ref|ZP_04864684.1 Staphylococcus aureus subsp. aureus USA300_TCH959 RefSeq   heme oxygenase
ref|ZP_05143563.2 Staphylococcus aureus subsp. aureus Mu50-omega RefSeq   heme-degrading monooxygenase IsdI
ref|ZP_05642999.1 Staphylococcus aureus A9781 RefSeq   heme-degrading monooxygenase IsdI
ref|ZP_05680857.1 Staphylococcus aureus A9763 RefSeq   heme-degrading monooxygenase isdI
ref|ZP_05684089.1 Staphylococcus aureus A9719 RefSeq   heme-degrading monooxygenase isdI
ref|ZP_05690003.1 Staphylococcus aureus A9299 RefSeq   heme-degrading monooxygenase isdI
ref|ZP_05692481.1 Staphylococcus aureus A8115 RefSeq   heme-degrading monooxygenase isdG
ref|ZP_05695176.1 Staphylococcus aureus A6300 RefSeq   heme-degrading monooxygenase isdI
ref|ZP_05696597.1 Staphylococcus aureus A6224 RefSeq   heme-degrading monooxygenase isdI
ref|ZP_05699629.1 Staphylococcus aureus A5948 RefSeq   heme-degrading monooxygenase isdI
ref|ZP_05703672.1 Staphylococcus aureus A5937 RefSeq   heme-degrading monooxygenase isdI
sp|A7WXE5 Staphylococcus aureus (strain Mu3 / ATCC 700698) SwissProt   Heme-degrading monooxygenase isdG
sp|ISDG_STAA1 organism not parsed/found in ncbi nr SwissProt   RecName: Full=Heme-degrading monooxygenase isdG; AltName: Full=Iron-regulated surface determinant isdG; AltName: Full=Iron-responsive surface determinant isdG; AltName: Full=Heme oxygenase
sp|ISDI_STAA3 organism not parsed/found in ncbi nr SwissProt   RecName: Full=Heme-degrading monooxygenase isdI; AltName: Full=Iron-regulated surface determinant isdI; AltName: Full=Iron-responsive surface determinant isdI; AltName: Full=Heme oxygenase
sp|ISDI_STAA8 organism not parsed/found in ncbi nr SwissProt   RecName: Full=Heme-degrading monooxygenase isdI; AltName: Full=Iron-regulated surface determinant isdI; AltName: Full=Iron-responsive surface determinant isdI; AltName: Full=Heme oxygenase
sp|ISDI_STAAC organism not parsed/found in ncbi nr SwissProt   RecName: Full=Heme-degrading monooxygenase isdI; AltName: Full=Iron-regulated surface determinant isdI; AltName: Full=Iron-responsive surface determinant isdI; AltName: Full=Heme oxygenase
sp|ISDI_STAAM organism not parsed/found in ncbi nr SwissProt   RecName: Full=Heme-degrading monooxygenase isdI; AltName: Full=Iron-regulated surface determinant isdI; AltName: Full=Iron-responsive surface determinant isdI; AltName: Full=Heme oxygenase
sp|ISDI_STAAN organism not parsed/found in ncbi nr SwissProt   RecName: Full=Heme-degrading monooxygenase isdI; AltName: Full=Iron-regulated surface determinant isdI; AltName: Full=Iron-responsive surface determinant isdI; AltName: Full=Heme oxygenase
sp|ISDI_STAAS organism not parsed/found in ncbi nr SwissProt   RecName: Full=Heme-degrading monooxygenase isdI; AltName: Full=Iron-regulated surface determinant isdI; AltName: Full=Iron-responsive surface determinant isdI; AltName: Full=Heme oxygenase
sp|ISDI_STAAW organism not parsed/found in ncbi nr SwissProt   RecName: Full=Heme-degrading monooxygenase isdG; AltName: Full=Iron-regulated surface determinant isdG; AltName: Full=Iron-responsive surface determinant isdG; AltName: Full=Heme oxygenase
sp|Q2FK96 Staphylococcus aureus (strain USA300) SwissProt   Heme-degrading monooxygenase isdI
sp|Q2G1J2 Staphylococcus aureus (strain NCTC 8325) SwissProt   Heme-degrading monooxygenase isdI
sp|Q5HJK5 Staphylococcus aureus (strain COL) SwissProt   Heme-degrading monooxygenase isdI
sp|Q6GCW1 Staphylococcus aureus (strain MSSA476) SwissProt   Heme-degrading monooxygenase isdI
sp|Q7A1Y8 Staphylococcus aureus (strain MW2) SwissProt   Heme-degrading monooxygenase isdG
sp|Q7A827 Staphylococcus aureus (strain N315) SwissProt   Heme-degrading monooxygenase isdI
sp|Q99X56 Staphylococcus aureus (strain Mu50 / ATCC 700699) SwissProt   Heme-degrading monooxygenase isdI
tr|A5IP35 Staphylococcus aureus (strain JH9) TrEMBL   Antibiotic biosynthesis monooxygenase
tr|A6QDF1 Staphylococcus aureus (strain Newman) TrEMBL   Putative uncharacterized protein
tr|A6TXV0 Staphylococcus aureus (strain JH1) TrEMBL   Antibiotic biosynthesis monooxygenase
tr|C5N142 Staphylococcus aureus subsp. aureus USA300_TCH959 TrEMBL   Heme oxygenase


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value
evidence_code dlit(14570922);RossO
evidence_code dlit(15520015);RossO


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search