The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|158879.11.peg.164: Staphylococcus aureus subsp. aureus N315

This feature in The SEED Viewer

NCBI Taxonomy Id: 158879

Current Assignment: Capsular polysaccharide synthesis enzyme Cap8P
Translate Function Assignments



Context on contig NC_002745 from base 177573 to 189467 (11895 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
159 177573 178778 1206 +           Capsular polysaccharide synthesis enzyme Cap5K gene_name|capK, locus|SA0154, protein_id|NP_373396.1, gi|15925863, geneID|1122929
160 178779 179984 1206 + 0         Capsular polysaccharide synthesis enzyme CapL gene_name|capL, locus|SA0155, protein_id|NP_373397.1, gi|15925864, geneID|1122930
161 179995 180552 558 + 10         Capsular polysaccharide synthesis enzyme CapM gene_name|capM, locus|SA0156, protein_id|NP_373398.1, gi|15925865, geneID|1122931
162 180552 181439 888 + -1         Capsular polysaccharide synthesis enzyme CapN gene_name|capN, locus|SA0157, protein_id|NP_373399.1, gi|15925866, geneID|1122932
163 181493 182755 1263 + 53 13   dlit(21454499) UDP-N-acetyl-D-mannosamine dehydrogenase (EC 1.1.1.336) gene_name|capO, locus|SA0158, protein_id|NP_373400.1, gi|15925867, geneID|1122933
164 182832 183977 1146 + 76       Capsular polysaccharide synthesis enzyme Cap8P gene_name|capP, locus|SA0159, protein_id|NP_373401.1, gi|15925868, geneID|1122934
165 184368 184042 327 - 64     1: 1 dlit(14570922)
dlit(15520015)
Heme-degrading monooxygenase, staphylobilin-producing (EC 1.14.99.48) # IsdI locus|SA0160, protein_id|NP_373402.1, gi|15925869, geneID|1122935
166 184758 184375 384 - 6     1: 1   Inner membrane protein YbaN locus|SA0161, protein_id|NP_373403.1, gi|15925870, geneID|1122936
167 185185 186672 1488 + 426     3: 6 2 3   Aldehyde dehydrogenase B (EC 1.2.1.22) gene_name|aldA, locus|SA0162, protein_id|NP_373404.1, gi|15925871, geneID|1122937
168 187319 188278 960 + 646     3: 5 4 7   Cobalt-zinc-cadmium resistance protein locus|SA0163, protein_id|NP_373405.1, gi|15925872, geneID|1122938
169 188407 188270 138 - -9         hypothetical protein  
170 188346 188525 180 + -62         hypothetical protein  
171 188543 188388 156 - -138         hypothetical protein locus|SAS005, protein_id|NP_373406.1, gi|15925873, geneID|1122939
172 188438 188590 153 + -106         hypothetical protein  
173 188776 188573 204 - -18         FIG01108246: hypothetical protein locus|SA0164, protein_id|NP_373407.1, gi|15925874, geneID|1122940
174 188955 189467 513 + 178         FIG01108032: hypothetical protein locus|SA0165, protein_id|NP_373408.1, gi|15925875, geneID|1122941

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|158879.11.peg.164 Capsular polysaccharide synthesis enzyme Cap8P
MKKIMVIFGTRPEAIKMAPLVKEIDHNGNFEANIVITAQHRDMLDSVLSIFDIQADHDLN
IMQDQQTLADLTANALAKLDSIINEEQPDMILVHGDTTTTFVGSLAAFYHQIPVGHVEAG
LRTHQKYSPFPEELNRVMVSNIAELNFAPTVIAAKNLLFENKDKERIFITGNTVIDALST
TVQNDFVSTIINKHKGKKVILLTAHRRENIGEPMHQIFKAVRDLADEYKDVVFIYPMHRN
PKVRAIAEKYLSGRNRIELIEPLDAIEFHNFTNQSYLVLTDSGGIQEEAPTFGKPVLVLR
NHTERPEGVEAGTSRVIGTDYDNIVRNVKQLIEDDEAYQRMSQANNPYGDGQASRRICEA
IEYYFGLRSDKPDEFVPLRHK

MD5 = 4cc54d6deec0019aa6eff38ca7f44171


  DNA Sequence

>fig|158879.11.peg.164 Capsular polysaccharide synthesis enzyme Cap8P
atgaaaaaaattatggttattttcggtacgagacccgaagcaataaaaatggcaccatta
gtaaaagaaattgatcataatgggaactttgaagcgaacattgtgattacagcacaacat
agagatatgttagatagtgtgttaagtatatttgatattcaagctgatcatgatttaaat
attatgcaagatcaacaaacgttagcggaccttacggcgaatgcgcttgctaaacttgat
agcatcattaatgaggaacagccggatatgattttagtacatggtgatactacaacgact
tttgtaggaagtttggcagcattttatcatcaaattccggttggacatgtagaagctgga
cttcgaacacatcagaaatactcaccatttcctgaagagttaaatcgagtcatggtaagt
aatattgctgaattgaattttgcgccaacagtaattgcagctaaaaatttactttttgaa
aacaaagacaaagagcgtatctttattactggaaatacagttattgacgcattgtcaaca
acagttcaaaatgattttgtttcaacgattattaataaacataaaggcaagaaagttatt
ttactaacagcgcatcgtcgtgaaaatattggggaaccgatgcatcagatttttaaagca
gtaagagatttggcagatgaatataaagatgttgtcttcatttatccaatgcatcgtaat
ccaaaggtaagagcgattgccgaaaaatatttatctgggagaaatcggattgaattaatt
gagccattagatgcgattgagttccataattttacaaatcaatcgtacctcgtgctgaca
gattctggtggtattcaagaggaggctcctacatttggaaaacctgtgttggtattaagg
aatcatacagagcgtcccgaaggcgttgaggcgggaacatcgagagtaattggcacagat
tatgacaatattgttcgaaatgtgaaacaattgattgaggatgatgaagcgtatcaacgt
atgagtcaagcgaataatccatatggtgatggacaagcatcacgacgtatttgtgaagca
atagaatattattttggattgcgctcagacaagccggatgaattcgtacctttacgtcac
aaataa


  DNA with Flanking Sequence

>fig|158879.11.peg.164 Capsular polysaccharide synthesis enzyme Cap8P
acgtgaaattaataattcaatgccggcctatgttgttgatacaacgaagcaaatcatcaa
agcgttgagcgggaataaagtcacagtatttggtttaacttataaaggtgatgttgatga
tataagagaatcgccagcatttgatatttatgagctattaaatcaagaaccagacataga
agtatgtgcttatgatccacatgttgaattagattttgtggaacatgatatgtcacatgc
tgtcaaagacgcatcgctagtattgattttaagtgaccactcagaatttaaaaatttatc
ggacagtcattttgataaaatgaagcataaagtgatttttgatacaaaaaatgttgtgaa
atcatcatttgaagatgtatcgtattataattatggcaatatatttaattttatcgacaa
ataaaatgtgtcaaactagggcatacatgattaaggaaagataagctgtcatgtgtttga
acttcagagaggataatgttatgaaaaaaattatggttattttcggtacgagacccgaag
caataaaaatggcaccattagtaaaagaaattgatcataatgggaactttgaagcgaaca
ttgtgattacagcacaacatagagatatgttagatagtgtgttaagtatatttgatattc
aagctgatcatgatttaaatattatgcaagatcaacaaacgttagcggaccttacggcga
atgcgcttgctaaacttgatagcatcattaatgaggaacagccggatatgattttagtac
atggtgatactacaacgacttttgtaggaagtttggcagcattttatcatcaaattccgg
ttggacatgtagaagctggacttcgaacacatcagaaatactcaccatttcctgaagagt
taaatcgagtcatggtaagtaatattgctgaattgaattttgcgccaacagtaattgcag
ctaaaaatttactttttgaaaacaaagacaaagagcgtatctttattactggaaatacag
ttattgacgcattgtcaacaacagttcaaaatgattttgtttcaacgattattaataaac
ataaaggcaagaaagttattttactaacagcgcatcgtcgtgaaaatattggggaaccga
tgcatcagatttttaaagcagtaagagatttggcagatgaatataaagatgttgtcttca
tttatccaatgcatcgtaatccaaaggtaagagcgattgccgaaaaatatttatctggga
gaaatcggattgaattaattgagccattagatgcgattgagttccataattttacaaatc
aatcgtacctcgtgctgacagattctggtggtattcaagaggaggctcctacatttggaa
aacctgtgttggtattaaggaatcatacagagcgtcccgaaggcgttgaggcgggaacat
cgagagtaattggcacagattatgacaatattgttcgaaatgtgaaacaattgattgagg
atgatgaagcgtatcaacgtatgagtcaagcgaataatccatatggtgatggacaagcat
cacgacgtatttgtgaagcaatagaatattattttggattgcgctcagacaagccggatg
aattcgtacctttacgtcacaaataataaaaaacccctaatcatgaagttggtttagaca
accagcggtgactaggggtttttaatatatttatttttgatagtggtagccaatatcata
tttgaatactttatttgataatattggactttgctgtccatcgtcatcactttttaaacg
tacatttttatgagcttctttaaatacatcggaattcaaccaattattaaagctatcttc
agattcccaaatagttaagattttaacttcgtctgtatcctcggtatttaatgttttagt
gacaaacatttgttggaagccttcaatagtttcaatgccttgtctattgtaaaaacgttc
aatcgtttcttccgcactgcctttttgtaattgtaatctattttctgccataaacatggg
caatcactcctctattttatgatttgatttgggtaatgtttttacaaatgtaaagagtac
agcggtttgtatgataaccattatgattaatcctacacggactgca


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0006047       P:UDP-N-acetylglucosamine metabolic process
GO:0008761       F:UDP-N-acetylglucosamine 2-epimerase activity
GO:0009103       P:lipopolysaccharide biosynthetic process
cmr|NT01SA0168 Staphylococcus aureus N315     UDP-N-acetylglucosamine 2-epimerase
cmr|NT02SA0161 Staphylococcus aureus Mu50     UDP-N-acetylglucosamine 2-epimerase
fig|158878.14.peg.162 Staphylococcus aureus subsp. aureus Mu50 FIG   Capsular polysaccharide synthesis enzyme Cap8P
fig|359786.13.peg.190 Staphylococcus aureus subsp. aureus JH9 FIG   Capsular polysaccharide synthesis enzyme Cap8P
fig|359786.3.peg.1177 Staphylococcus aureus subsp. aureus JH9 FIG   Capsular polysaccharide synthesis enzyme Cap8P
fig|359787.11.peg.187 Staphylococcus aureus subsp. aureus JH1 FIG   Capsular polysaccharide synthesis enzyme Cap8P
fig|359787.3.peg.1985 Staphylococcus aureus subsp. aureus JH1 FIG   Capsular polysaccharide synthesis enzyme Cap8P
fig|418127.4.peg.147 Staphylococcus aureus subsp. aureus Mu3 FIG   Capsular polysaccharide synthesis enzyme Cap8P
fig|505321.3.peg.1837 Staphylococcus aureus subsp. aureus str. CF-Marseille FIG   Capsular polysaccharide synthesis enzyme Cap8P
fig|553568.3.peg.797 Staphylococcus aureus A6224 FIG   Capsular polysaccharide synthesis enzyme Cap8P
fig|553571.3.peg.2067 Staphylococcus aureus A6300 FIG   Capsular polysaccharide synthesis enzyme Cap8P
fig|553573.3.peg.1958 Staphylococcus aureus A8115 FIG   Capsular polysaccharide synthesis enzyme Cap8P
fig|553577.3.peg.838 Staphylococcus aureus A8796 FIG   Capsular polysaccharide synthesis enzyme Cap8P
fig|553580.3.peg.574 Staphylococcus aureus A8819 FIG   Capsular polysaccharide synthesis enzyme Cap8P
fig|553581.3.peg.2089 Staphylococcus aureus A9299 FIG   Capsular polysaccharide synthesis enzyme Cap8P
fig|553588.3.peg.1475 Staphylococcus aureus A9719 FIG   Capsular polysaccharide synthesis enzyme Cap8P
fig|553592.3.peg.852 Staphylococcus aureus A9763 FIG   Capsular polysaccharide synthesis enzyme Cap8P
fig|553596.3.peg.897 Staphylococcus aureus A9781 FIG   Capsular polysaccharide synthesis enzyme Cap8P
fig|553601.3.peg.27 Staphylococcus aureus A10102 FIG   Capsular polysaccharide synthesis enzyme Cap8P
fig|585891.3.peg.162 Staphylococcus aureus subsp. aureus Mu50-omega FIG   Capsular polysaccharide synthesis enzyme Cap8P
fig|680649.3.peg.1636 Staphylococcus aureus subsp. aureus MR1 FIG   Capsular polysaccharide synthesis enzyme Cap8P
fig|681288.4.peg.131 Staphylococcus aureus subsp. aureus ED98 FIG   Capsular polysaccharide synthesis enzyme Cap8P
fig|703339.3.peg.165 Staphylococcus aureus 04-02981 FIG   Capsular polysaccharide synthesis enzyme Cap8P
gb|ABQ47957.1 Staphylococcus aureus subsp. aureus JH9     UDP-N-Acetylglucosamine 2-epimerase
gb|ABR51017.1 Staphylococcus aureus subsp. aureus JH1     UDP-N-acetylglucosamine 2-epimerase
gi|147739659 Staphylococcus aureus subsp. aureus JH9 NCBI   UDP-N-Acetylglucosamine 2-epimerase
gi|148266590 Staphylococcus aureus subsp. aureus JH9 NCBI   UDP-N-acetylglucosamine 2-epimerase
gi|149945081 Staphylococcus aureus subsp. aureus JH1 NCBI   UDP-N-acetylglucosamine 2-epimerase
gi|150392629 Staphylococcus aureus subsp. aureus JH1 NCBI   UDP-N-acetylglucosamine 2-epimerase
gi|253316304 Staphylococcus aureus subsp. aureus str. CF-Marseille NCBI   capsular polysaccharide synthesis enzyme Cap5P
gi|255004961 Staphylococcus aureus subsp. aureus Mu50-omega NCBI   capsular polysaccharide synthesis enzyme Cap5P
img|639108490 Staphylococcus aureus aureus JH1 IMG   UDP-N-acetylglucosamine 2-epimerase( EC:5.1.3.14 )
img|640564480 Staphylococcus aureus aureus JH9 IMG   UDP-N-acetylglucosamine 2-epimerase( EC:5.1.3.14 )
img|640778225 Staphylococcus aureus aureus JH1 IMG   UDP-N-acetylglucosamine 2-epimerase( EC:5.1.3.14 )
kegg|sah:SaurJH1_0155 Staphylococcus aureus subsp. aureus JH1 KEGG   UDP-N-acetylglucosamine 2-epimerase (EC:5.1.3.14)
kegg|saj:SaurJH9_0150 Staphylococcus aureus subsp. aureus JH9 KEGG   UDP-N-acetylglucosamine 2-epimerase (EC:5.1.3.14)
ref|YP_001245533.1 Staphylococcus aureus subsp. aureus JH9 RefSeq   UDP-N-acetylglucosamine 2-epimerase
ref|YP_001315304.1 Staphylococcus aureus subsp. aureus JH1 RefSeq   UDP-N-acetylglucosamine 2-epimerase
ref|ZP_04839517.1 Staphylococcus aureus subsp. aureus str. CF-Marseille RefSeq   capsular polysaccharide synthesis enzyme Cap5P
ref|ZP_05143562.2 Staphylococcus aureus subsp. aureus Mu50-omega RefSeq   capsular polysaccharide synthesis enzyme Cap5P
tr|A5IP34 Staphylococcus aureus (strain JH9) TrEMBL   UDP-N-acetylglucosamine 2-epimerase
tr|A6TXU9 Staphylococcus aureus (strain JH1) TrEMBL   UDP-N-acetylglucosamine 2-epimerase


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function
13 fig|158879.11.peg.163 UDP-N-acetyl-D-mannosamine dehydrogenase (EC 1.1.1.336)


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search