The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|158879.11.peg.162: Staphylococcus aureus subsp. aureus N315

This feature in The SEED Viewer

NCBI Taxonomy Id: 158879

Current Assignment: Capsular polysaccharide synthesis enzyme CapN
Translate Function Assignments



Context on contig NC_002745 from base 175291 to 186672 (11382 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
157 175291 176400 1110 +           Capsular polysaccharide synthesis enzyme CapI gene_name|capI, locus|SA0152, protein_id|NP_373394.1, gi|15925861, geneID|1122927
158 176414 177580 1167 + 13         Capsular polysaccharide synthesis enzyme Cap5J gene_name|capJ, locus|SA0153, protein_id|NP_373395.1, gi|15925862, geneID|1122928
159 177573 178778 1206 + -8         Capsular polysaccharide synthesis enzyme Cap5K gene_name|capK, locus|SA0154, protein_id|NP_373396.1, gi|15925863, geneID|1122929
160 178779 179984 1206 + 0 6     Capsular polysaccharide synthesis enzyme CapL gene_name|capL, locus|SA0155, protein_id|NP_373397.1, gi|15925864, geneID|1122930
161 179995 180552 558 + 10 10     Capsular polysaccharide synthesis enzyme CapM gene_name|capM, locus|SA0156, protein_id|NP_373398.1, gi|15925865, geneID|1122931
162 180552 181439 888 + -1       Capsular polysaccharide synthesis enzyme CapN gene_name|capN, locus|SA0157, protein_id|NP_373399.1, gi|15925866, geneID|1122932
163 181493 182755 1263 + 53 4   dlit(21454499) UDP-N-acetyl-D-mannosamine dehydrogenase (EC 1.1.1.336) gene_name|capO, locus|SA0158, protein_id|NP_373400.1, gi|15925867, geneID|1122933
164 182832 183977 1146 + 76         Capsular polysaccharide synthesis enzyme Cap8P gene_name|capP, locus|SA0159, protein_id|NP_373401.1, gi|15925868, geneID|1122934
165 184368 184042 327 - 64     1: 1 dlit(14570922)
dlit(15520015)
Heme-degrading monooxygenase, staphylobilin-producing (EC 1.14.99.48) # IsdI locus|SA0160, protein_id|NP_373402.1, gi|15925869, geneID|1122935
166 184758 184375 384 - 6     1: 1   Inner membrane protein YbaN locus|SA0161, protein_id|NP_373403.1, gi|15925870, geneID|1122936
167 185185 186672 1488 + 426     3: 2 3 4   Aldehyde dehydrogenase B (EC 1.2.1.22) gene_name|aldA, locus|SA0162, protein_id|NP_373404.1, gi|15925871, geneID|1122937

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|158879.11.peg.162 Capsular polysaccharide synthesis enzyme CapN
MRKNILITGVHGYIGNALKDKLIEQGHQVDQINVRNQLWKSTSFKDYDVLIHTAALVHNN
SPQARLSDYMQVNMLLTKQLAQKAKAEDVKQFIFMSTMAVYGKEGQVGKSDQIDTQTPMN
PTTNYGISKKFAEQALQELISDSFKVAIVRPPMIYGAHCPGNFQRLMQLSKRLPIIPNIN
NQRSALYIKHLTAFIDQLISLEVTGVYHPQDSFYFDTSSVMYEIRRQSHRKTVLINMPSV
LNKYFNKLSVFRKLFGNLTYSNTLYENNNALEVIPGKMSLVIADIMDETTTKDKA

MD5 = c8823ed3ca8acba98df326dd023d14d2


  DNA Sequence

>fig|158879.11.peg.162 Capsular polysaccharide synthesis enzyme CapN
atgagaaaaaatattttaattacaggcgtacatggatatatcggtaatgctttaaaagat
aagcttattgaacaaggacatcaagtagatcaaattaatgttaggaatcaattatggaag
tcgacctcgttcaaagattatgatgttttaattcatacagcagctttggttcacaacaat
tcacctcaagcaaggctatctgattatatgcaagtgaatatgttgcttacgaaacaattg
gcacaaaaggctaaagctgaagacgttaaacaatttatttttatgagtactatggcagtt
tatggaaaagaaggtcaggttggtaaatcagatcaaattgatacacaaacaccaatgaac
cctacgaccaactatggtatttccaaaaagttcgctgaacaagcattacaagagttgatt
agtgattcgtttaaagtagcaattgtgagaccaccaatgatttatggtgcacattgccca
ggaaatttccaacggttaatgcaattgtcaaagcgactgccaatcattcccaatattaac
aatcagcgcagtgcattatatattaaacatctgacagcatttattgatcaattaatatca
ttagaagtgacaggcgtgtatcatcctcaagatagtttttactttgatacatcgtcagta
atgtatgaaatacgtcgccaatcacatcgtaaaacggtattgatcaacatgccttcagtg
ttaaataagtattttaataagttgtcggtctttagaaaattattcggcaatttaacatac
agcaatacgttatatgaaaataataatgcacttgaagttattcctggaaaaatgtcactt
gttattgcggacatcatggatgaaacgacaaccaaagataaggcataa


  DNA with Flanking Sequence

>fig|158879.11.peg.162 Capsular polysaccharide synthesis enzyme CapN
attctgttaattacagcattactaattaaaatggaatcacctggaccagccattttcaaa
caaaaaagaccgacgattaataatgaattgtttaatatttataagtttagatcaatgaaa
atagacacacctaatgttgcaactgatttaatggattcaacatcgtatataacaaagaca
gggaaggtcattcgtaagacctctattgatgaattgccacaattattgaatgttttaaaa
ggagaaatgtcaattgtaggtcctagaccagcgctttataatcaatacgaattaatcgaa
aaacgtacaaaagcgaacgtgcatacgattagaccaggtgtgacaggactagctcaagtg
atggggagagatgatattactgatgatcaaaaagtagcgtatgatcattattacttaaca
catcaatctatgatgcttgatatgtatatcatatataaaacaattaaaaatatcgttact
tcagaaggtgtgcatcactaatgagaaaaaatattttaattacaggcgtacatggatata
tcggtaatgctttaaaagataagcttattgaacaaggacatcaagtagatcaaattaatg
ttaggaatcaattatggaagtcgacctcgttcaaagattatgatgttttaattcatacag
cagctttggttcacaacaattcacctcaagcaaggctatctgattatatgcaagtgaata
tgttgcttacgaaacaattggcacaaaaggctaaagctgaagacgttaaacaatttattt
ttatgagtactatggcagtttatggaaaagaaggtcaggttggtaaatcagatcaaattg
atacacaaacaccaatgaaccctacgaccaactatggtatttccaaaaagttcgctgaac
aagcattacaagagttgattagtgattcgtttaaagtagcaattgtgagaccaccaatga
tttatggtgcacattgcccaggaaatttccaacggttaatgcaattgtcaaagcgactgc
caatcattcccaatattaacaatcagcgcagtgcattatatattaaacatctgacagcat
ttattgatcaattaatatcattagaagtgacaggcgtgtatcatcctcaagatagttttt
actttgatacatcgtcagtaatgtatgaaatacgtcgccaatcacatcgtaaaacggtat
tgatcaacatgccttcagtgttaaataagtattttaataagttgtcggtctttagaaaat
tattcggcaatttaacatacagcaatacgttatatgaaaataataatgcacttgaagtta
ttcctggaaaaatgtcacttgttattgcggacatcatggatgaaacgacaaccaaagata
aggcataagtcatctattaaataaaatcaacatacaaatcgttttatttggaggttatag
tatgaagttaacagtagttggcttaggttatattggtttaccaacatcaattatgtttgc
aaagcatggcgtcgatgtgcttggtgttgatattaatcagcaaacgattgataagttaca
aagtggtcaaattagtattgaagaacctgggttacaagaggtttatgaagaggtactgtc
atcgggaaaattgaaggtatctacaacgccagaagcatctgatgtttttatcattgccgt
tccgacgccgaataatgatgatcagtaccggtcatgtgacatttcgctagttatgcgtgc
attagatagtattttaccatttttagaaaaagggaatactattattgtagagtcgacaat
tgcgcctaaaacgatggatgattttgtaaaaccagtcattgaaaatttaggatttacaat
aggtgaagatatttgtttagtgcattgt


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0003824       F:catalytic activity
GO:0044237       P:cellular metabolic process
GO:0050662       F:coenzyme binding
cmr|NT01SA0166 Staphylococcus aureus N315     cap5N protein/UDP-glucose 4-epimerase, putative
cmr|NT02SA0159 Staphylococcus aureus Mu50     capsular polysaccharide synthesis enzyme Cap5N
dbj|BAB41377.1 Staphylococcus aureus subsp. aureus N315     capsular polysaccharide synthesis enzyme Cap5N
dbj|BAB56324.1 Staphylococcus aureus subsp. aureus Mu50     capsular polysaccharide synthesis enzyme Cap5N
dbj|BAF77044.1 Staphylococcus aureus subsp. aureus Mu3     capsular polysaccharide synthesis enzyme Cap5N
fig|158878.1.peg.162 Staphylococcus aureus subsp. aureus Mu50 FIG   Capsular polysaccharide synthesis enzyme CapN
fig|158878.14.peg.160 Staphylococcus aureus subsp. aureus Mu50 FIG   Capsular polysaccharide synthesis enzyme CapN
fig|158879.1.peg.160 Staphylococcus aureus subsp. aureus N315 FIG   Capsular polysaccharide synthesis enzyme CapN
fig|359786.13.peg.188 Staphylococcus aureus subsp. aureus JH9 FIG   Capsular polysaccharide synthesis enzyme CapN
fig|359786.3.peg.1179 Staphylococcus aureus subsp. aureus JH9 FIG   Capsular polysaccharide synthesis enzyme CapN
fig|359787.11.peg.185 Staphylococcus aureus subsp. aureus JH1 FIG   Capsular polysaccharide synthesis enzyme CapN
fig|359787.3.peg.1986 Staphylococcus aureus subsp. aureus JH1 FIG   Capsular polysaccharide synthesis enzyme CapN
fig|418127.4.peg.145 Staphylococcus aureus subsp. aureus Mu3 FIG   Capsular polysaccharide synthesis enzyme CapN
fig|418127.6.peg.159 Staphylococcus aureus subsp. aureus Mu3 FIG   Capsular polysaccharide synthesis enzyme CapN
fig|505321.3.peg.1839 Staphylococcus aureus subsp. aureus str. CF-Marseille FIG   Capsular polysaccharide synthesis enzyme CapN
fig|553565.3.peg.2480 Staphylococcus aureus A5937 FIG   Capsular polysaccharide synthesis enzyme CapN
fig|553568.3.peg.795 Staphylococcus aureus A6224 FIG   Capsular polysaccharide synthesis enzyme CapN
fig|553571.3.peg.2065 Staphylococcus aureus A6300 FIG   Capsular polysaccharide synthesis enzyme CapN
fig|553573.3.peg.1956 Staphylococcus aureus A8115 FIG   Capsular polysaccharide synthesis enzyme CapN
fig|553574.3.peg.1721 Staphylococcus aureus A8117 FIG   Capsular polysaccharide synthesis enzyme CapN
fig|553577.3.peg.836 Staphylococcus aureus A8796 FIG   Capsular polysaccharide synthesis enzyme CapN
fig|553580.3.peg.572 Staphylococcus aureus A8819 FIG   Capsular polysaccharide synthesis enzyme CapN
fig|553581.3.peg.2087 Staphylococcus aureus A9299 FIG   Capsular polysaccharide synthesis enzyme CapN
fig|553588.3.peg.1473 Staphylococcus aureus A9719 FIG   Capsular polysaccharide synthesis enzyme CapN
fig|553592.3.peg.850 Staphylococcus aureus A9763 FIG   Capsular polysaccharide synthesis enzyme CapN
fig|553596.3.peg.899 Staphylococcus aureus A9781 FIG   Capsular polysaccharide synthesis enzyme CapN
fig|553601.3.peg.25 Staphylococcus aureus A10102 FIG   Capsular polysaccharide synthesis enzyme CapN
fig|585891.3.peg.160 Staphylococcus aureus subsp. aureus Mu50-omega FIG   Capsular polysaccharide synthesis enzyme CapN
fig|680649.3.peg.1634 Staphylococcus aureus subsp. aureus MR1 FIG   Capsular polysaccharide synthesis enzyme CapN
fig|681288.4.peg.129 Staphylococcus aureus subsp. aureus ED98 FIG   Capsular polysaccharide synthesis enzyme CapN
fig|703339.3.peg.163 Staphylococcus aureus 04-02981 FIG   Capsular polysaccharide synthesis enzyme CapN
gb|ABQ47955.1 Staphylococcus aureus subsp. aureus JH9     NAD-dependent epimerase/dehydratase
gb|ABR51015.1 Staphylococcus aureus subsp. aureus JH1     NAD-dependent epimerase/dehydratase
gb|EEV26335.1 Staphylococcus aureus A9781     capsular polysaccharide synthesis enzyme Cap5N
gb|EEV65037.1 Staphylococcus aureus A9763     capsular polysaccharide synthesis enzyme Cap5N
gb|EEV67005.1 Staphylococcus aureus A9719     capsular polysaccharide synthesis enzyme Cap5N
gb|EEV71781.1 Staphylococcus aureus A9299     capsular polysaccharide synthesis enzyme Cap5N
gb|EEV74351.1 Staphylococcus aureus A8115     capsular polysaccharide synthesis enzyme Cap5N
gb|EEV76989.1 Staphylococcus aureus A6300     capsular polysaccharide synthesis enzyme Cap5N
gb|EEV81000.1 Staphylococcus aureus A6224     capsular polysaccharide synthesis enzyme Cap5N
gb|EEV84699.1 Staphylococcus aureus A5937     capsular polysaccharide synthesis enzyme Cap5N
gi|13700078 Staphylococcus aureus subsp. aureus N315 NCBI   capsular polysaccharide synthesis enzyme Cap5N
gi|14245929 Staphylococcus aureus subsp. aureus Mu50 NCBI   capsular polysaccharide synthesis enzyme Cap5N
gi|147739657 Staphylococcus aureus subsp. aureus JH9 NCBI   NAD-dependent epimerase/dehydratase
gi|148266588 Staphylococcus aureus subsp. aureus JH9 NCBI   NAD-dependent epimerase/dehydratase
gi|149945079 Staphylococcus aureus subsp. aureus JH1 NCBI   NAD-dependent epimerase/dehydratase
gi|150392627 Staphylococcus aureus subsp. aureus JH1 NCBI   NAD-dependent epimerase/dehydratase
gi|156720627 Staphylococcus aureus subsp. aureus Mu3 NCBI   capsular polysaccharide synthesis enzyme Cap5N
gi|156978492 Staphylococcus aureus subsp. aureus Mu3 NCBI   capsular polysaccharide synthesis enzyme Cap5N
gi|15923152 Staphylococcus aureus subsp. aureus Mu50 NCBI   capsular polysaccharide synthesis enzyme Cap5N
gi|15925866 Staphylococcus aureus subsp. aureus N315 NCBI   capsular polysaccharide synthesis enzyme Cap5N
gi|253316306 Staphylococcus aureus subsp. aureus str. CF-Marseille NCBI   capsular polysaccharide synthesis enzyme Cap5N
gi|255004959 Staphylococcus aureus subsp. aureus Mu50-omega NCBI   capsular polysaccharide synthesis enzyme Cap5N
gi|257787995 Staphylococcus aureus A9781 NCBI   capsular polysaccharide synthesis enzyme Cap5N
gi|257794023 Staphylococcus aureus A9781 NCBI   capsular polysaccharide synthesis enzyme Cap5N
gi|257840578 Staphylococcus aureus A9763 NCBI   capsular polysaccharide synthesis enzyme Cap5N
gi|257842583 Staphylococcus aureus A9719 NCBI   capsular polysaccharide synthesis enzyme Cap5N
gi|257847785 Staphylococcus aureus A9299 NCBI   capsular polysaccharide synthesis enzyme Cap5N
gi|257850403 Staphylococcus aureus A8115 NCBI   capsular polysaccharide synthesis enzyme Cap5N
gi|257854036 Staphylococcus aureus A6300 NCBI   capsular polysaccharide synthesis enzyme Cap5N
gi|257858112 Staphylococcus aureus A6224 NCBI   capsular polysaccharide synthesis enzyme Cap5N
gi|257861926 Staphylococcus aureus A5937 NCBI   capsular polysaccharide synthesis enzyme Cap5N
gi|258408569 Staphylococcus aureus A9763 NCBI   capsular polysaccharide synthesis enzyme Cap5N
gi|258421159 Staphylococcus aureus A9719 NCBI   capsular polysaccharide synthesis enzyme Cap5N
gi|258438909 Staphylococcus aureus A9299 NCBI   capsular polysaccharide synthesis enzyme Cap5N
gi|258444144 Staphylococcus aureus A8115 NCBI   capsular polysaccharide synthesis enzyme Cap5N
gi|258447023 Staphylococcus aureus A6300 NCBI   capsular polysaccharide synthesis enzyme Cap5N
gi|258448481 Staphylococcus aureus A6224 NCBI   capsular polysaccharide synthesis enzyme Cap5N
gi|258455714 Staphylococcus aureus A5937 NCBI   capsular polysaccharide synthesis enzyme Cap5N
img|637091757 Staphylococcus aureus aureus N315 IMG   capsular polysaccharide synthesis enzyme Cap5N
img|637098661 Staphylococcus aureus aureus Mu50 IMG   capsular polysaccharide synthesis enzyme Cap5N
img|639108492 Staphylococcus aureus aureus JH1 IMG   NAD-dependent epimerase/dehydratase:3-beta hydroxysteroid dehydrogenase/isomerase:dTDP-4-dehydrorhamnose reductase
img|640564478 Staphylococcus aureus aureus JH9 IMG   NAD-dependent epimerase/dehydratase
img|640778223 Staphylococcus aureus aureus JH1 IMG   NAD-dependent epimerase/dehydratase
img|640902883 Staphylococcus aureus aureus Mu3 IMG   capsular polysaccharide synthesis enzyme Cap5N
kegg|sah:SaurJH1_0153 Staphylococcus aureus subsp. aureus JH1 KEGG   NAD-dependent epimerase/dehydratase
kegg|saj:SaurJH9_0148 Staphylococcus aureus subsp. aureus JH9 KEGG   NAD-dependent epimerase/dehydratase
kegg|sau:SA0157   KEGG   capsular polysaccharide synthesis enzyme Cap5N
kegg|sav:SAV0162   KEGG   capsular polysaccharide synthesis enzyme Cap5N
kegg|saw:SAHV_0161 Staphylococcus aureus subsp. aureus Mu3 KEGG   capsular polysaccharide synthesis enzyme Cap5N
ref|NP_370686.1 Staphylococcus aureus subsp. aureus Mu50 RefSeq   capsular polysaccharide synthesis enzyme Cap5N
ref|NP_373399.1 Staphylococcus aureus subsp. aureus N315 RefSeq   capsular polysaccharide synthesis enzyme Cap5N
ref|YP_001245531.1 Staphylococcus aureus subsp. aureus JH9 RefSeq   NAD-dependent epimerase/dehydratase
ref|YP_001315302.1 Staphylococcus aureus subsp. aureus JH1 RefSeq   NAD-dependent epimerase/dehydratase
ref|YP_001440751.1 Staphylococcus aureus subsp. aureus Mu3 RefSeq   capsular polysaccharide synthesis enzyme Cap5N
ref|ZP_04839519.1 Staphylococcus aureus subsp. aureus str. CF-Marseille RefSeq   capsular polysaccharide synthesis enzyme Cap5N
ref|ZP_05143560.2 Staphylococcus aureus subsp. aureus Mu50-omega RefSeq   capsular polysaccharide synthesis enzyme Cap5N
ref|ZP_05643002.1 Staphylococcus aureus A9781 RefSeq   capsular polysaccharide synthesis enzyme Cap5N
ref|ZP_05680854.1 Staphylococcus aureus A9763 RefSeq   capsular polysaccharide synthesis enzyme Cap5N
ref|ZP_05684086.1 Staphylococcus aureus A9719 RefSeq   capsular polysaccharide synthesis enzyme Cap5N
ref|ZP_05690000.1 Staphylococcus aureus A9299 RefSeq   capsular polysaccharide synthesis enzyme Cap5N
ref|ZP_05692478.1 Staphylococcus aureus A8115 RefSeq   capsular polysaccharide synthesis enzyme Cap5N
ref|ZP_05695173.1 Staphylococcus aureus A6300 RefSeq   capsular polysaccharide synthesis enzyme Cap5N
ref|ZP_05696594.1 Staphylococcus aureus A6224 RefSeq   capsular polysaccharide synthesis enzyme Cap5N
ref|ZP_05703669.1 Staphylococcus aureus A5937 RefSeq   capsular polysaccharide synthesis enzyme Cap5N
tr|A5IP32 Staphylococcus aureus (strain JH9) TrEMBL   NAD-dependent epimerase/dehydratase
tr|A6TXU7 Staphylococcus aureus (strain JH1) TrEMBL   NAD-dependent epimerase/dehydratase
tr|A7WXE1 Staphylococcus aureus (strain Mu3 / ATCC 700698) TrEMBL   Capsular polysaccharide synthesis enzyme Cap5N
tr|Q7A830 Staphylococcus aureus (strain N315) TrEMBL   Capsular polysaccharide synthesis enzyme Cap5N
tr|Q99X59 Staphylococcus aureus (strain Mu50 / ATCC 700699) TrEMBL   Capsular polysaccharide synthesis enzyme Cap5N


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function
6 fig|158879.11.peg.160 Capsular polysaccharide synthesis enzyme CapL
10 fig|158879.11.peg.161 Capsular polysaccharide synthesis enzyme CapM
4 fig|158879.11.peg.163 UDP-N-acetyl-D-mannosamine dehydrogenase (EC 1.1.1.336)


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search