The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|158879.11.peg.161: Staphylococcus aureus subsp. aureus N315

This feature in The SEED Viewer

NCBI Taxonomy Id: 158879

Current Assignment: Capsular polysaccharide synthesis enzyme CapM
Translate Function Assignments



Context on contig NC_002745 from base 174660 to 186672 (12013 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
156 174660 175286 627 +           Capsular polysaccharide synthesis enzyme Cap5H; O-acetyl transferase gene_name|capH, locus|SA0151, protein_id|NP_373393.1, gi|15925860, geneID|1122926
157 175291 176400 1110 + 4         Capsular polysaccharide synthesis enzyme CapI gene_name|capI, locus|SA0152, protein_id|NP_373394.1, gi|15925861, geneID|1122927
158 176414 177580 1167 + 13         Capsular polysaccharide synthesis enzyme Cap5J gene_name|capJ, locus|SA0153, protein_id|NP_373395.1, gi|15925862, geneID|1122928
159 177573 178778 1206 + -8         Capsular polysaccharide synthesis enzyme Cap5K gene_name|capK, locus|SA0154, protein_id|NP_373396.1, gi|15925863, geneID|1122929
160 178779 179984 1206 + 0 10     Capsular polysaccharide synthesis enzyme CapL gene_name|capL, locus|SA0155, protein_id|NP_373397.1, gi|15925864, geneID|1122930
161 179995 180552 558 + 10       Capsular polysaccharide synthesis enzyme CapM gene_name|capM, locus|SA0156, protein_id|NP_373398.1, gi|15925865, geneID|1122931
162 180552 181439 888 + -1 14     Capsular polysaccharide synthesis enzyme CapN gene_name|capN, locus|SA0157, protein_id|NP_373399.1, gi|15925866, geneID|1122932
163 181493 182755 1263 + 53 7   dlit(21454499) UDP-N-acetyl-D-mannosamine dehydrogenase (EC 1.1.1.336) gene_name|capO, locus|SA0158, protein_id|NP_373400.1, gi|15925867, geneID|1122933
164 182832 183977 1146 + 76         Capsular polysaccharide synthesis enzyme Cap8P gene_name|capP, locus|SA0159, protein_id|NP_373401.1, gi|15925868, geneID|1122934
165 184368 184042 327 - 64     1: 1 dlit(14570922)
dlit(15520015)
Heme-degrading monooxygenase, staphylobilin-producing (EC 1.14.99.48) # IsdI locus|SA0160, protein_id|NP_373402.1, gi|15925869, geneID|1122935
166 184758 184375 384 - 6     1: 1   Inner membrane protein YbaN locus|SA0161, protein_id|NP_373403.1, gi|15925870, geneID|1122936
167 185185 186672 1488 + 426     3: 2 3 4   Aldehyde dehydrogenase B (EC 1.2.1.22) gene_name|aldA, locus|SA0162, protein_id|NP_373404.1, gi|15925871, geneID|1122937

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|158879.11.peg.161 Capsular polysaccharide synthesis enzyme CapM
MKRLFDVVSSIYGLVVLSPILLITALLIKMESPGPAIFKQKRPTINNELFNIYKFRSMKI
DTPNVATDLMDSTSYITKTGKVIRKTSIDELPQLLNVLKGEMSIVGPRPALYNQYELIEK
RTKANVHTIRPGVTGLAQVMGRDDITDDQKVAYDHYYLTHQSMMLDMYIIYKTIKNIVTS
EGVHH

MD5 = d26c57f1f089c14f6c3cecc2254e004b


  DNA Sequence

>fig|158879.11.peg.161 Capsular polysaccharide synthesis enzyme CapM
atgaagcgattattcgatgtagtgagttcaatatatggtttagtagttttaagtccgatt
ctgttaattacagcattactaattaaaatggaatcacctggaccagccattttcaaacaa
aaaagaccgacgattaataatgaattgtttaatatttataagtttagatcaatgaaaata
gacacacctaatgttgcaactgatttaatggattcaacatcgtatataacaaagacaggg
aaggtcattcgtaagacctctattgatgaattgccacaattattgaatgttttaaaagga
gaaatgtcaattgtaggtcctagaccagcgctttataatcaatacgaattaatcgaaaaa
cgtacaaaagcgaacgtgcatacgattagaccaggtgtgacaggactagctcaagtgatg
gggagagatgatattactgatgatcaaaaagtagcgtatgatcattattacttaacacat
caatctatgatgcttgatatgtatatcatatataaaacaattaaaaatatcgttacttca
gaaggtgtgcatcactaa


  DNA with Flanking Sequence

>fig|158879.11.peg.161 Capsular polysaccharide synthesis enzyme CapM
ggagacacttatctcatttttaaaattaaataaggatcagcctcaaacgttaacaatact
ttgtggtcatggtaagaaatttgcagatgtcaaaacggcaatagaagaccatcgtattga
aaatgttaaaatgtttgagtttttaacaggtacagactatgctgacgtattaaaaattgc
ggatgtatgtattgcatcgctgattaaagaaggcgtcggtttaggcgttccgagcaagaa
ttatggctaccttgcagctaagaaaccgttggtactcatcatggataagcaatctgatat
cgttcaacatgttgaacaatatgatgcgggtatccaaattgataatggcgatgcacatgc
catttataacttcatcaacactcactcgagtaaggaattgcacgagatgggtgagcgcgc
acatcaactgtttaaagataaatatacgagagaaattaatactatgaagtattacaatct
gttgaagtgaggagataattatgaagcgattattcgatgtagtgagttcaatatatggtt
tagtagttttaagtccgattctgttaattacagcattactaattaaaatggaatcacctg
gaccagccattttcaaacaaaaaagaccgacgattaataatgaattgtttaatatttata
agtttagatcaatgaaaatagacacacctaatgttgcaactgatttaatggattcaacat
cgtatataacaaagacagggaaggtcattcgtaagacctctattgatgaattgccacaat
tattgaatgttttaaaaggagaaatgtcaattgtaggtcctagaccagcgctttataatc
aatacgaattaatcgaaaaacgtacaaaagcgaacgtgcatacgattagaccaggtgtga
caggactagctcaagtgatggggagagatgatattactgatgatcaaaaagtagcgtatg
atcattattacttaacacatcaatctatgatgcttgatatgtatatcatatataaaacaa
ttaaaaatatcgttacttcagaaggtgtgcatcactaatgagaaaaaatattttaattac
aggcgtacatggatatatcggtaatgctttaaaagataagcttattgaacaaggacatca
agtagatcaaattaatgttaggaatcaattatggaagtcgacctcgttcaaagattatga
tgttttaattcatacagcagctttggttcacaacaattcacctcaagcaaggctatctga
ttatatgcaagtgaatatgttgcttacgaaacaattggcacaaaaggctaaagctgaaga
cgttaaacaatttatttttatgagtactatggcagtttatggaaaagaaggtcaggttgg
taaatcagatcaaattgatacacaaacaccaatgaaccctacgaccaactatggtatttc
caaaaagttcgctgaacaagcattacaagagttgattagtgattcgtttaaagtagcaat
tgtgagaccaccaatgatttatggtgcacattgcccaggaaatttccaacggttaatg


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0016740       F:transferase activity
GO:0016757       F:transferase activity, transferring glycosyl...
cmr|NT01SA0165 Staphylococcus aureus N315     capsular polysaccharide biosynthesis protein Cps4E
cmr|NT02SA0158 Staphylococcus aureus Mu50     capsular polysaccharide synthesis enzyme Cap5M
cmr|NT05SA0113 Staphylococcus aureus NCTC 8325     sugar transferase
cmr|NT11SA0109 Staphylococcus aureus RF122     capsular polysaccharide biosynthesis galactosyltransferase Cap5M
cmr|SACOL0148 Staphylococcus aureus subsp. aureus COL     capsular polysaccharide biosynthesis galactosyltransferase Cap5M
cmr|SAUSA300_0164 Staphylococcus aureus subsp. aureus USA300-FPR3757     capsular polysaccharide biosynthesis protein Cap5M
dbj|BAB41376.1 Staphylococcus aureus subsp. aureus N315     capsular polysaccharide synthesis enzyme Cap5M
dbj|BAB56323.1 Staphylococcus aureus subsp. aureus Mu50     capsular polysaccharide synthesis enzyme Cap5M
dbj|BAF66379.1 Staphylococcus aureus subsp. aureus str. Newman     capsular polysaccharide biosynthesis protein CapM
dbj|BAF77043.1 Staphylococcus aureus subsp. aureus Mu3     capsular polysaccharide synthesis enzyme Cap5M
emb|CAI79790.1 Staphylococcus aureus RF122 EMBL   capsular polysaccharide synthesis enzyme CapM
fig|158878.1.peg.161 Staphylococcus aureus subsp. aureus Mu50 FIG   Capsular polysaccharide synthesis enzyme CapM
fig|158878.14.peg.159 Staphylococcus aureus subsp. aureus Mu50 FIG   Capsular polysaccharide synthesis enzyme CapM
fig|158879.1.peg.159 Staphylococcus aureus subsp. aureus N315 FIG   Capsular polysaccharide synthesis enzyme CapM
fig|273036.3.peg.221 Staphylococcus aureus RF122 FIG   Capsular polysaccharide synthesis enzyme CapM
fig|273036.6.peg.117 Staphylococcus aureus RF122 FIG   Capsular polysaccharide synthesis enzyme CapM
fig|359786.13.peg.187 Staphylococcus aureus subsp. aureus JH9 FIG   Capsular polysaccharide synthesis enzyme CapM
fig|359786.3.peg.1129 Staphylococcus aureus subsp. aureus JH9 FIG   Capsular polysaccharide synthesis enzyme CapM
fig|359787.11.peg.184 Staphylococcus aureus subsp. aureus JH1 FIG   Capsular polysaccharide synthesis enzyme CapM
fig|359787.3.peg.2005 Staphylococcus aureus subsp. aureus JH1 FIG   Capsular polysaccharide synthesis enzyme CapM
fig|367830.3.peg.1454 Staphylococcus aureus subsp. aureus USA300 FIG   Capsular polysaccharide synthesis enzyme CapM
fig|418127.4.peg.144 Staphylococcus aureus subsp. aureus Mu3 FIG   Capsular polysaccharide synthesis enzyme CapM
fig|418127.6.peg.158 Staphylococcus aureus subsp. aureus Mu3 FIG   Capsular polysaccharide synthesis enzyme CapM
fig|426430.6.peg.108 Staphylococcus aureus subsp. aureus str. Newman FIG   Capsular polysaccharide synthesis enzyme CapM
fig|426430.8.peg.116 Staphylococcus aureus subsp. aureus str. Newman FIG   Capsular polysaccharide synthesis enzyme CapM
fig|450394.6.peg.1921 Staphylococcus aureus subsp. aureus USA300_TCH959 FIG   Capsular polysaccharide synthesis enzyme CapM
fig|451515.3.peg.223 Staphylococcus aureus subsp. aureus USA300_FPR3757 FIG   Capsular polysaccharide synthesis enzyme CapM
fig|451516.9.peg.212 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   Capsular polysaccharide synthesis enzyme CapM
fig|452948.4.peg.14 Staphylococcus aureus 930918-3 FIG   Capsular polysaccharide synthesis enzyme CapM
fig|455227.3.peg.177 Staphylococcus aureus D30 FIG   Capsular polysaccharide synthesis enzyme CapM
fig|505321.3.peg.1840 Staphylococcus aureus subsp. aureus str. CF-Marseille FIG   Capsular polysaccharide synthesis enzyme CapM
fig|548474.3.peg.8 Staphylococcus aureus subsp. aureus TCH130 FIG   Capsular polysaccharide synthesis enzyme CapM
fig|553565.3.peg.2479 Staphylococcus aureus A5937 FIG   Capsular polysaccharide synthesis enzyme CapM
fig|553567.3.peg.1088 Staphylococcus aureus A5948 FIG   Capsular polysaccharide synthesis enzyme CapM
fig|553568.3.peg.794 Staphylococcus aureus A6224 FIG   Capsular polysaccharide synthesis enzyme CapM
fig|553571.3.peg.2064 Staphylococcus aureus A6300 FIG   Capsular polysaccharide synthesis enzyme CapM
fig|553573.3.peg.1955 Staphylococcus aureus A8115 FIG   Capsular polysaccharide synthesis enzyme CapM
fig|553574.3.peg.1720 Staphylococcus aureus A8117 FIG   Capsular polysaccharide synthesis enzyme CapM
fig|553577.3.peg.835 Staphylococcus aureus A8796 FIG   Capsular polysaccharide synthesis enzyme CapM
fig|553580.3.peg.571 Staphylococcus aureus A8819 FIG   Capsular polysaccharide synthesis enzyme CapM
fig|553581.3.peg.2086 Staphylococcus aureus A9299 FIG   Capsular polysaccharide synthesis enzyme CapM
fig|553588.3.peg.1472 Staphylococcus aureus A9719 FIG   Capsular polysaccharide synthesis enzyme CapM
fig|553590.4.peg.1166 Staphylococcus aureus A9754 FIG   Capsular polysaccharide synthesis enzyme CapM
fig|553592.3.peg.849 Staphylococcus aureus A9763 FIG   Capsular polysaccharide synthesis enzyme CapM
fig|553594.3.peg.825 Staphylococcus aureus A9765 FIG   Capsular polysaccharide synthesis enzyme CapM
fig|553596.3.peg.900 Staphylococcus aureus A9781 FIG   Capsular polysaccharide synthesis enzyme CapM
fig|553601.3.peg.24 Staphylococcus aureus A10102 FIG   Capsular polysaccharide synthesis enzyme CapM
fig|585152.3.peg.77 Staphylococcus aureus subsp. aureus D139 FIG   Capsular polysaccharide synthesis enzyme CapM
fig|585155.3.peg.396 Staphylococcus aureus subsp. aureus H19 FIG   Capsular polysaccharide synthesis enzyme CapM
fig|585891.3.peg.159 Staphylococcus aureus subsp. aureus Mu50-omega FIG   Capsular polysaccharide synthesis enzyme CapM
fig|644279.4.peg.233 Staphylococcus aureus subsp. aureus 132 FIG   Capsular polysaccharide synthesis enzyme CapM
fig|680649.3.peg.1633 Staphylococcus aureus subsp. aureus MR1 FIG   Capsular polysaccharide synthesis enzyme CapM
fig|681288.4.peg.128 Staphylococcus aureus subsp. aureus ED98 FIG   Capsular polysaccharide synthesis enzyme CapM
fig|703339.3.peg.162 Staphylococcus aureus 04-02981 FIG   Capsular polysaccharide synthesis enzyme CapM
fig|93061.3.peg.139 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Capsular polysaccharide synthesis enzyme CapM
fig|93061.5.peg.118 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Capsular polysaccharide synthesis enzyme CapM
fig|93062.19.peg.146 Staphylococcus aureus subsp. aureus COL FIG   Capsular polysaccharide synthesis enzyme CapM
fig|93062.4.peg.615 Staphylococcus aureus subsp. aureus COL FIG   Capsular polysaccharide synthesis enzyme CapM
gb|AAC46096.1 Staphylococcus aureus     Cap5M
gb|AAW37445.1 Staphylococcus aureus subsp. aureus COL     capsular polysaccharide biosynthesis galactosyltransferase Cap5M
gb|ABD21970.1 Staphylococcus aureus subsp. aureus USA300_FPR3757     capsular polysaccharide biosynthesis protein Cap5M
gb|ABD29307.1 Staphylococcus aureus subsp. aureus NCTC 8325     capsular polysaccharide biosynthesis protein Cap8M
gb|ABQ47954.1 Staphylococcus aureus subsp. aureus JH9     sugar transferase
gb|ABR51014.1 Staphylococcus aureus subsp. aureus JH1     sugar transferase
gb|ABX28207.1 Staphylococcus aureus subsp. aureus USA300_TCH1516     capsular polysaccharide biosynthesis protein Cap5M
gb|EES94493.1 Staphylococcus aureus subsp. aureus USA300_TCH959     galactosyltransferase
gb|EES97002.1 Staphylococcus aureus subsp. aureus TCH130     galactosyltransferase
gb|EEV26336.1 Staphylococcus aureus A9781     sugar transferase
gb|EEV65036.1 Staphylococcus aureus A9763     sugar transferase
gb|EEV67004.1 Staphylococcus aureus A9719     sugar transferase
gb|EEV71780.1 Staphylococcus aureus A9299     capsular polysaccharide synthesis enzyme Cap5M
gb|EEV74350.1 Staphylococcus aureus A8115     capsular polysaccharide synthesis enzyme Cap5M
gb|EEV76988.1 Staphylococcus aureus A6300     capsular polysaccharide synthesis enzyme CapM
gb|EEV80999.1 Staphylococcus aureus A6224     capsular polysaccharide synthesis enzyme CapM
gb|EEV83469.1 Staphylococcus aureus A5948     capsular polysaccharide synthesis enzyme Cap5M
gb|EEV84698.1 Staphylococcus aureus A5937     sugar transferase
gb|EEW45978.1 Staphylococcus aureus 930918-3     capsular polysaccharide synthesis enzyme Cap5M
gb|EEW48120.1 Staphylococcus aureus D30     capsular polysaccharide synthesis enzyme Cap5M
gi|13700077 Staphylococcus aureus subsp. aureus N315 NCBI   capsular polysaccharide synthesis enzyme Cap5M
gi|14245928 Staphylococcus aureus subsp. aureus Mu50 NCBI   capsular polysaccharide synthesis enzyme Cap5M
gi|147739656 Staphylococcus aureus subsp. aureus JH9 NCBI   sugar transferase
gi|148266587 Staphylococcus aureus subsp. aureus JH9 NCBI   sugar transferase
gi|149945078 Staphylococcus aureus subsp. aureus JH1 NCBI   sugar transferase
gi|150373119 Staphylococcus aureus subsp. aureus str. Newman NCBI   capsular polysaccharide biosynthesis protein CapM
gi|150392626 Staphylococcus aureus subsp. aureus JH1 NCBI   sugar transferase
gi|151220319 Staphylococcus aureus subsp. aureus str. Newman NCBI   capsular polysaccharide biosynthesis protein CapM
gi|156720626 Staphylococcus aureus subsp. aureus Mu3 NCBI   capsular polysaccharide synthesis enzyme Cap5M
gi|156978491 Staphylococcus aureus subsp. aureus Mu3 NCBI   capsular polysaccharide synthesis enzyme Cap5M
gi|15923151 Staphylococcus aureus subsp. aureus Mu50 NCBI   capsular polysaccharide synthesis enzyme Cap5M
gi|15925865 Staphylococcus aureus subsp. aureus N315 NCBI   capsular polysaccharide synthesis enzyme Cap5M
gi|160367236 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   capsular polysaccharide biosynthesis protein Cap5M
gi|161508427 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   capsular polysaccharide biosynthesis protein Cap5M
gi|1773352 Staphylococcus aureus NCBI   Cap5M
gi|253316307 Staphylococcus aureus subsp. aureus str. CF-Marseille NCBI   capsular polysaccharide biosynthesis protein Cap5M
gi|253725764 Staphylococcus aureus subsp. aureus USA300_TCH959 NCBI   galactosyltransferase
gi|253728273 Staphylococcus aureus subsp. aureus TCH130 NCBI   galactosyltransferase
gi|253730515 Staphylococcus aureus subsp. aureus USA300_TCH959 NCBI   galactosyltransferase
gi|253733732 Staphylococcus aureus subsp. aureus TCH130 NCBI   galactosyltransferase
gi|255004958 Staphylococcus aureus subsp. aureus Mu50-omega NCBI   capsular polysaccharide biosynthesis protein Cap5M
gi|257787996 Staphylococcus aureus A9781 NCBI   sugar transferase
gi|257794024 Staphylococcus aureus A9781 NCBI   sugar transferase
gi|257840577 Staphylococcus aureus A9763 NCBI   sugar transferase
gi|257842582 Staphylococcus aureus A9719 NCBI   sugar transferase
gi|257847784 Staphylococcus aureus A9299 NCBI   capsular polysaccharide synthesis enzyme Cap5M
gi|257850402 Staphylococcus aureus A8115 NCBI   capsular polysaccharide synthesis enzyme Cap5M
gi|257854035 Staphylococcus aureus A6300 NCBI   capsular polysaccharide synthesis enzyme CapM
gi|257858111 Staphylococcus aureus A6224 NCBI   capsular polysaccharide synthesis enzyme CapM
gi|257860647 Staphylococcus aureus A5948 NCBI   capsular polysaccharide synthesis enzyme Cap5M
gi|257861925 Staphylococcus aureus A5937 NCBI   sugar transferase
gi|258408568 Staphylococcus aureus A9763 NCBI   sugar transferase
gi|258421158 Staphylococcus aureus A9719 NCBI   sugar transferase
gi|258438908 Staphylococcus aureus A9299 NCBI   capsular polysaccharide synthesis enzyme Cap5M
gi|258444143 Staphylococcus aureus A8115 NCBI   capsular polysaccharide synthesis enzyme Cap5M
gi|258447022 Staphylococcus aureus A6300 NCBI   capsular polysaccharide synthesis enzyme CapM
gi|258448480 Staphylococcus aureus A6224 NCBI   capsular polysaccharide synthesis enzyme CapM
gi|258451599 Staphylococcus aureus A5948 NCBI   capsular polysaccharide synthesis enzyme Cap5M
gi|258455713 Staphylococcus aureus A5937 NCBI   sugar transferase
gi|259160959 Staphylococcus aureus 930918-3 NCBI   capsular polysaccharide synthesis enzyme Cap5M
gi|259163564 Staphylococcus aureus D30 NCBI   capsular polysaccharide synthesis enzyme Cap5M
gi|57285351 Staphylococcus aureus subsp. aureus COL NCBI   capsular polysaccharide biosynthesis galactosyltransferase Cap5M
gi|57651165 Staphylococcus aureus subsp. aureus COL NCBI   capsular polysaccharide biosynthesis galactosyltransferase Cap5M
gi|82655405 Staphylococcus aureus RF122 NCBI   capsular polysaccharide synthesis enzyme CapM
gi|82749874 Staphylococcus aureus RF122 NCBI   capsular polysaccharide synthesis enzyme CapM
gi|87127456 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   capsular polysaccharide biosynthesis protein Cap5M
gi|87161482 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   capsular polysaccharide biosynthesis protein Cap5M
gi|87201497 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   capsular polysaccharide biosynthesis protein Cap8M
gi|88193939 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   capsular polysaccharide biosynthesis protein Cap8M
img|637091756 Staphylococcus aureus aureus N315 IMG   capsular polysaccharide synthesis enzyme Cap5M
img|637098660 Staphylococcus aureus aureus Mu50 IMG   capsular polysaccharide synthesis enzyme Cap5M
img|637150931 Staphylococcus aureus aureus COL IMG   capsular polysaccharide biosynthesis galactosyltransferase Cap5M
img|637815065 Staphylococcus aureus RF122 IMG   capsular polysaccharide synthesis enzyme CapM
img|637886819 Staphylococcus aureus aureus USA300 IMG   capsular polysaccharide biosynthesis protein Cap5M
img|637892800 Staphylococcus aureus aureus NCTC 8325 IMG   capsular polysaccharide biosynthesis protein Cap8M
img|639108493 Staphylococcus aureus aureus JH1 IMG   sugar transferase
img|640564477 Staphylococcus aureus aureus JH9 IMG   sugar transferase
img|640778222 Staphylococcus aureus aureus JH1 IMG   sugar transferase
img|640794467 Staphylococcus aureus aureus Newman IMG   capsular polysaccharide biosynthesis protein CapM
img|640902882 Staphylococcus aureus aureus Mu3 IMG   capsular polysaccharide synthesis enzyme Cap5M
img|641308135 Staphylococcus aureus subsp. aureus USA300_TCH1516 IMG   capsular polysaccharide biosynthesis protein Cap5M( EC:2.4.1.- )
img|641771881 Staphylococcus aureus aureus USA300_TCH959 IMG   capsular polysaccharide biosynthesis protein Cap5M
kegg|saa:SAUSA300_0164 Staphylococcus aureus subsp. aureus USA300_FPR3757 KEGG   capsular polysaccharide biosynthesis protein Cap5M
kegg|sab:SAB0102 Staphylococcus aureus RF122 KEGG   capsular polysaccharide synthesis enzyme CapM
kegg|sac:SACOL0148 Staphylococcus aureus subsp. aureus COL KEGG   capsular polysaccharide biosynthesis galactosyltransferase Cap5M
kegg|sae:NWMN_0107 Staphylococcus aureus subsp. aureus Newman KEGG   capsular polysaccharide biosynthesis protein CapM
kegg|sah:SaurJH1_0152 Staphylococcus aureus subsp. aureus JH1 KEGG   sugar transferase
kegg|saj:SaurJH9_0147 Staphylococcus aureus subsp. aureus JH9 KEGG   sugar transferase
kegg|sao:SAOUHSC_00126 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   capsular polysaccharide biosynthesis protein Cap8M
kegg|sau:SA0156   KEGG   capsular polysaccharide synthesis enzyme Cap5M
kegg|sav:SAV0161   KEGG   capsular polysaccharide synthesis enzyme Cap5M
kegg|saw:SAHV_0160 Staphylococcus aureus subsp. aureus Mu3 KEGG   capsular polysaccharide synthesis enzyme Cap5M
kegg|sax:USA300HOU_0175 Staphylococcus aureus subsp. aureus USA300_TCH1516 KEGG   capsular polysaccharide biosynthesis protein Cap5M (EC:2.4.1.-)
ref|NP_370685.1 Staphylococcus aureus subsp. aureus Mu50 RefSeq   capsular polysaccharide synthesis enzyme Cap5M
ref|NP_373398.1 Staphylococcus aureus subsp. aureus N315 RefSeq   capsular polysaccharide synthesis enzyme Cap5M
ref|YP_001245530.1 Staphylococcus aureus subsp. aureus JH9 RefSeq   sugar transferase
ref|YP_001315301.1 Staphylococcus aureus subsp. aureus JH1 RefSeq   sugar transferase
ref|YP_001331142.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   capsular polysaccharide biosynthesis protein CapM
ref|YP_001440750.1 Staphylococcus aureus subsp. aureus Mu3 RefSeq   capsular polysaccharide synthesis enzyme Cap5M
ref|YP_001574086.1 Staphylococcus aureus subsp. aureus USA300_TCH1516 RefSeq   capsular polysaccharide biosynthesis protein Cap5M
ref|YP_185048.1 Staphylococcus aureus subsp. aureus COL RefSeq   capsular polysaccharide biosynthesis galactosyltransferase Cap5M
ref|YP_415615.1 Staphylococcus aureus RF122 RefSeq   capsular polysaccharide synthesis enzyme CapM
ref|YP_492878.1 Staphylococcus aureus subsp. aureus USA300_FPR3757 RefSeq   capsular polysaccharide biosynthesis protein Cap5M
ref|YP_498726.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   capsular polysaccharide biosynthesis protein Cap8M
ref|ZP_04839520.1 Staphylococcus aureus subsp. aureus str. CF-Marseille RefSeq   capsular polysaccharide biosynthesis protein Cap5M
ref|ZP_04864680.1 Staphylococcus aureus subsp. aureus USA300_TCH959 RefSeq   galactosyltransferase
ref|ZP_04867897.1 Staphylococcus aureus subsp. aureus TCH130 RefSeq   galactosyltransferase
ref|ZP_05143559.2 Staphylococcus aureus subsp. aureus Mu50-omega RefSeq   capsular polysaccharide biosynthesis protein Cap5M
ref|ZP_05643003.1 Staphylococcus aureus A9781 RefSeq   sugar transferase
ref|ZP_05680853.1 Staphylococcus aureus A9763 RefSeq   sugar transferase
ref|ZP_05684085.1 Staphylococcus aureus A9719 RefSeq   sugar transferase
ref|ZP_05689999.1 Staphylococcus aureus A9299 RefSeq   capsular polysaccharide synthesis enzyme Cap5M
ref|ZP_05692477.1 Staphylococcus aureus A8115 RefSeq   capsular polysaccharide synthesis enzyme Cap5M
ref|ZP_05695172.1 Staphylococcus aureus A6300 RefSeq   capsular polysaccharide synthesis enzyme CapM
ref|ZP_05696593.1 Staphylococcus aureus A6224 RefSeq   capsular polysaccharide synthesis enzyme CapM
ref|ZP_05699625.1 Staphylococcus aureus A5948 RefSeq   capsular polysaccharide synthesis enzyme Cap5M
ref|ZP_05703668.1 Staphylococcus aureus A5937 RefSeq   sugar transferase
tr|A5IP31 Staphylococcus aureus (strain JH9) TrEMBL   Sugar transferase
tr|A6QDE7 Staphylococcus aureus (strain Newman) TrEMBL   Capsular polysaccharide biosynthesis protein CapM
tr|A6TXU6 Staphylococcus aureus (strain JH1) TrEMBL   Sugar transferase
tr|A7WXD9 Staphylococcus aureus (strain Mu3 / ATCC 700698) TrEMBL   Capsular polysaccharide synthesis enzyme Cap5M
tr|A8YZ84 Staphylococcus aureus (strain USA300 / TCH1516) TrEMBL   Capsular polysaccharide biosynthesis protein Cap5M
tr|C5N138 Staphylococcus aureus subsp. aureus USA300_TCH959 TrEMBL   Galactosyltransferase
tr|C5Q178 Staphylococcus aureus subsp. aureus TCH130 TrEMBL   Galactosyltransferase
tr|P95706 Staphylococcus aureus TrEMBL   Cap5M
tr|Q2FKA0 Staphylococcus aureus (strain USA300) TrEMBL   Capsular polysaccharide biosynthesis protein Cap5M
tr|Q2G1J6 Staphylococcus aureus (strain NCTC 8325) TrEMBL   Capsular polysaccharide biosynthesis protein Cap8M
tr|Q2YUW9 Staphylococcus aureus (strain bovine RF122 / ET3-1) TrEMBL   Capsular polysaccharide synthesis enzyme CapM
tr|Q5HJK9 Staphylococcus aureus (strain COL) TrEMBL   Capsular polysaccharide biosynthesis galactosyltransferase Cap5M
tr|Q7A2Y0 Staphylococcus aureus (strain Mu50 / ATCC 700699) TrEMBL   Capsular polysaccharide synthesis enzyme Cap5M
tr|Q7A831 Staphylococcus aureus (strain N315) TrEMBL   Capsular polysaccharide synthesis enzyme Cap5M


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function
10 fig|158879.11.peg.160 Capsular polysaccharide synthesis enzyme CapL
14 fig|158879.11.peg.162 Capsular polysaccharide synthesis enzyme CapN
7 fig|158879.11.peg.163 UDP-N-acetyl-D-mannosamine dehydrogenase (EC 1.1.1.336)


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search