The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|158879.11.peg.160: Staphylococcus aureus subsp. aureus N315

This feature in The SEED Viewer

NCBI Taxonomy Id: 158879

Current Assignment: Capsular polysaccharide synthesis enzyme CapL
Translate Function Assignments



Context on contig NC_002745 from base 173533 to 184758 (11226 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
155 173533 174657 1125 +   15 1: 2 dlit(15778500) UDP-N-acetyl-L-fucosamine synthase (EC 5.1.3.28) gene_name|capG, locus|SA0150, protein_id|NP_373392.1, gi|15925859, geneID|1122925
156 174660 175286 627 + 2         Capsular polysaccharide synthesis enzyme Cap5H; O-acetyl transferase gene_name|capH, locus|SA0151, protein_id|NP_373393.1, gi|15925860, geneID|1122926
157 175291 176400 1110 + 4 7     Capsular polysaccharide synthesis enzyme CapI gene_name|capI, locus|SA0152, protein_id|NP_373394.1, gi|15925861, geneID|1122927
158 176414 177580 1167 + 13         Capsular polysaccharide synthesis enzyme Cap5J gene_name|capJ, locus|SA0153, protein_id|NP_373395.1, gi|15925862, geneID|1122928
159 177573 178778 1206 + -8         Capsular polysaccharide synthesis enzyme Cap5K gene_name|capK, locus|SA0154, protein_id|NP_373396.1, gi|15925863, geneID|1122929
160 178779 179984 1206 + 0       Capsular polysaccharide synthesis enzyme CapL gene_name|capL, locus|SA0155, protein_id|NP_373397.1, gi|15925864, geneID|1122930
161 179995 180552 558 + 10 6     Capsular polysaccharide synthesis enzyme CapM gene_name|capM, locus|SA0156, protein_id|NP_373398.1, gi|15925865, geneID|1122931
162 180552 181439 888 + -1         Capsular polysaccharide synthesis enzyme CapN gene_name|capN, locus|SA0157, protein_id|NP_373399.1, gi|15925866, geneID|1122932
163 181493 182755 1263 + 53       dlit(21454499) UDP-N-acetyl-D-mannosamine dehydrogenase (EC 1.1.1.336) gene_name|capO, locus|SA0158, protein_id|NP_373400.1, gi|15925867, geneID|1122933
164 182832 183977 1146 + 76         Capsular polysaccharide synthesis enzyme Cap8P gene_name|capP, locus|SA0159, protein_id|NP_373401.1, gi|15925868, geneID|1122934
165 184368 184042 327 - 64     1: 1 dlit(14570922)
dlit(15520015)
Heme-degrading monooxygenase, staphylobilin-producing (EC 1.14.99.48) # IsdI locus|SA0160, protein_id|NP_373402.1, gi|15925869, geneID|1122935
166 184758 184375 384 - 6     1: 1   Inner membrane protein YbaN locus|SA0161, protein_id|NP_373403.1, gi|15925870, geneID|1122936

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|158879.11.peg.160 Capsular polysaccharide synthesis enzyme CapL
MSEKKILILCQYFYPEYVSSATLPTQLAEDLIANHINVDVMCGWPYEYSNHKQVSKTEMH
RGIRIRRLKYSRFNNKSKVGRIINFFSLFSKFVINIPKMLKYDQILVYSNPPILPLIPDV
LHRLLKKKYSFVVYDIAPDNAIKTGATRPGSMIDKLMRYINRHVYKNAENVIVLGTEMKN
YLLNHQISKNADNIHVIPNWYDMRQLQDNRIYNDTFKAYREQYDKILLYSGNMGQLQDME
TLISFLKLNKDQPQTLTILCGHGKKFADVKTAIEDHRIENVKMFEFLTGTDYADVLKIAD
VCIASLIKEGVGLGVPSKNYGYLAAKKPLVLIMDKQSDIVQHVEQYDAGIQIDNGDAHAI
YNFINTHSSKELHEMGERAHQLFKDKYTREINTMKYYNLLK

MD5 = 57103ad83dfbcb2367f7acc478075894


  DNA Sequence

>fig|158879.11.peg.160 Capsular polysaccharide synthesis enzyme CapL
atgagtgaaaaaaagattttgattttatgtcagtatttttatccggaatatgtatcttct
gcgacgttaccaactcaattggcggaagatttaattgcgaatcacattaatgtcgatgtc
atgtgtggatggccatatgaatatagtaatcataaacaggtttctaaaaccgagatgcat
cgtggaattcgcattcgacgtctcaagtattcgaggtttaataacaaaagtaaggttgga
aggatcatcaatttctttagtttattttcaaaattcgtgattaatatacctaaaatgttg
aaatatgatcagattcttgtttactctaatccaccaatcttgccattaataccagacgtt
ttacacagactgcttaagaaaaaatattcttttgtggtgtatgatatagcacctgataat
gcgattaagacaggtgcaactcgtccaggtagcatgattgataagctgatgcgttacatt
aatagacatgtctacaagaatgctgaaaatgtcattgtccttggtacggaaatgaaaaac
tacttactaaatcatcaaatttctaaaaatgctgacaatatccatgtgattcctaactgg
tatgacatgcgtcaattacaagacaatcgtatctataatgacacatttaaagcttaccgt
gagcaatacgacaaaattttattgtatagcggtaatatggggcagttacaggatatggag
acacttatctcatttttaaaattaaataaggatcagcctcaaacgttaacaatactttgt
ggtcatggtaagaaatttgcagatgtcaaaacggcaatagaagaccatcgtattgaaaat
gttaaaatgtttgagtttttaacaggtacagactatgctgacgtattaaaaattgcggat
gtatgtattgcatcgctgattaaagaaggcgtcggtttaggcgttccgagcaagaattat
ggctaccttgcagctaagaaaccgttggtactcatcatggataagcaatctgatatcgtt
caacatgttgaacaatatgatgcgggtatccaaattgataatggcgatgcacatgccatt
tataacttcatcaacactcactcgagtaaggaattgcacgagatgggtgagcgcgcacat
caactgtttaaagataaatatacgagagaaattaatactatgaagtattacaatctgttg
aagtga


  DNA with Flanking Sequence

>fig|158879.11.peg.160 Capsular polysaccharide synthesis enzyme CapL
catttctttcaacatttattgggaaaatgttagctacatttctgtatccgattaataatg
tagtactttcatatatttctgtaaatgaaagcgacaatataaagaagcaatatttgaaaa
ctaatctatttgctatagctgcactatgtttagtcatgattatatgttatccaattacat
taattattgtctctttactgtataacattgattcaagtttatattcgaagtttattattt
taggtaatataggtgttttattcaatgcagtgagtattatgatccaaactttaaatacaa
aacacgcatcaataacattacaagcgaattatatgacgcttcacacgattacatttatat
tcataactattttaatgacaattgcgtttggtctaaatggattcttttggacaacgctgt
tcagcaacattattaagtatgtgattttaaatattataggtttaaagtctaaattcatta
ataaaaaggacgtcgattagatgagtgaaaaaaagattttgattttatgtcagtattttt
atccggaatatgtatcttctgcgacgttaccaactcaattggcggaagatttaattgcga
atcacattaatgtcgatgtcatgtgtggatggccatatgaatatagtaatcataaacagg
tttctaaaaccgagatgcatcgtggaattcgcattcgacgtctcaagtattcgaggttta
ataacaaaagtaaggttggaaggatcatcaatttctttagtttattttcaaaattcgtga
ttaatatacctaaaatgttgaaatatgatcagattcttgtttactctaatccaccaatct
tgccattaataccagacgttttacacagactgcttaagaaaaaatattcttttgtggtgt
atgatatagcacctgataatgcgattaagacaggtgcaactcgtccaggtagcatgattg
ataagctgatgcgttacattaatagacatgtctacaagaatgctgaaaatgtcattgtcc
ttggtacggaaatgaaaaactacttactaaatcatcaaatttctaaaaatgctgacaata
tccatgtgattcctaactggtatgacatgcgtcaattacaagacaatcgtatctataatg
acacatttaaagcttaccgtgagcaatacgacaaaattttattgtatagcggtaatatgg
ggcagttacaggatatggagacacttatctcatttttaaaattaaataaggatcagcctc
aaacgttaacaatactttgtggtcatggtaagaaatttgcagatgtcaaaacggcaatag
aagaccatcgtattgaaaatgttaaaatgtttgagtttttaacaggtacagactatgctg
acgtattaaaaattgcggatgtatgtattgcatcgctgattaaagaaggcgtcggtttag
gcgttccgagcaagaattatggctaccttgcagctaagaaaccgttggtactcatcatgg
ataagcaatctgatatcgttcaacatgttgaacaatatgatgcgggtatccaaattgata
atggcgatgcacatgccatttataacttcatcaacactcactcgagtaaggaattgcacg
agatgggtgagcgcgcacatcaactgtttaaagataaatatacgagagaaattaatacta
tgaagtattacaatctgttgaagtgaggagataattatgaagcgattattcgatgtagtg
agttcaatatatggtttagtagttttaagtccgattctgttaattacagcattactaatt
aaaatggaatcacctggaccagccattttcaaacaaaaaagaccgacgattaataatgaa
ttgtttaatatttataagtttagatcaatgaaaatagacacacctaatgttgcaactgat
ttaatggattcaacatcgtatataacaaagacagggaaggtcattcgtaagacctctatt
gatgaattgccacaattattgaatgttttaaaaggagaaatgtcaattgtaggtcctaga
ccagcgctttataatcaatacgaattaatcgaaaaacgtacaaaagcgaacgtgcatacg
attagaccaggtgtgacaggactagctcaagtgatggggagagatgatattactgatgat
caaaaagtagcgtatgatcattattacttaacacatcaatctatga


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0009058       P:biosynthetic process
GO:0016740       F:transferase activity
cmr|NT01SA0164 Staphylococcus aureus N315     cap5L protein/glycosyltransferase, putative
cmr|NT02SA0157 Staphylococcus aureus Mu50     capsular polysaccharide synthesis enzyme Cap5L
dbj|BAB41375.1 Staphylococcus aureus subsp. aureus N315     capsular polysaccharide synthesis enzyme Cap5L
dbj|BAB56322.1 Staphylococcus aureus subsp. aureus Mu50     capsular polysaccharide synthesis enzyme Cap5L
dbj|BAF77042.1 Staphylococcus aureus subsp. aureus Mu3     capsular polysaccharide synthesis enzyme Cap5L
fig|158878.1.peg.160 Staphylococcus aureus subsp. aureus Mu50 FIG   Capsular polysaccharide synthesis enzyme CapL
fig|158878.14.peg.158 Staphylococcus aureus subsp. aureus Mu50 FIG   Capsular polysaccharide synthesis enzyme CapL
fig|158879.1.peg.158 Staphylococcus aureus subsp. aureus N315 FIG   Capsular polysaccharide synthesis enzyme CapL
fig|359786.13.peg.186 Staphylococcus aureus subsp. aureus JH9 FIG   Capsular polysaccharide synthesis enzyme CapL
fig|359786.3.peg.1130 Staphylococcus aureus subsp. aureus JH9 FIG   Capsular polysaccharide synthesis enzyme CapL
fig|359787.11.peg.183 Staphylococcus aureus subsp. aureus JH1 FIG   Capsular polysaccharide synthesis enzyme CapL
fig|359787.3.peg.2006 Staphylococcus aureus subsp. aureus JH1 FIG   Capsular polysaccharide synthesis enzyme CapL
fig|418127.4.peg.143 Staphylococcus aureus subsp. aureus Mu3 FIG   Capsular polysaccharide synthesis enzyme CapL
fig|418127.6.peg.157 Staphylococcus aureus subsp. aureus Mu3 FIG   Capsular polysaccharide synthesis enzyme CapL
fig|505321.3.peg.1841 Staphylococcus aureus subsp. aureus str. CF-Marseille FIG   Capsular polysaccharide synthesis enzyme CapL
fig|553565.3.peg.2478 Staphylococcus aureus A5937 FIG   Capsular polysaccharide synthesis enzyme CapL
fig|553568.3.peg.793 Staphylococcus aureus A6224 FIG   Capsular polysaccharide synthesis enzyme CapL
fig|553571.3.peg.2063 Staphylococcus aureus A6300 FIG   Capsular polysaccharide synthesis enzyme CapL
fig|553573.3.peg.1954 Staphylococcus aureus A8115 FIG   Capsular polysaccharide synthesis enzyme CapL
fig|553574.3.peg.1719 Staphylococcus aureus A8117 FIG   Capsular polysaccharide synthesis enzyme CapL
fig|553577.3.peg.834 Staphylococcus aureus A8796 FIG   Capsular polysaccharide synthesis enzyme CapL
fig|553581.3.peg.2085 Staphylococcus aureus A9299 FIG   Capsular polysaccharide synthesis enzyme CapL
fig|553588.3.peg.1471 Staphylococcus aureus A9719 FIG   Capsular polysaccharide synthesis enzyme CapL
fig|553592.3.peg.848 Staphylococcus aureus A9763 FIG   Capsular polysaccharide synthesis enzyme CapL
fig|553596.3.peg.901 Staphylococcus aureus A9781 FIG   Capsular polysaccharide synthesis enzyme CapL
fig|553601.3.peg.23 Staphylococcus aureus A10102 FIG   Capsular polysaccharide synthesis enzyme CapL
fig|680649.3.peg.1632 Staphylococcus aureus subsp. aureus MR1 FIG   Capsular polysaccharide synthesis enzyme CapL
fig|681288.4.peg.127 Staphylococcus aureus subsp. aureus ED98 FIG   Capsular polysaccharide synthesis enzyme CapL
fig|703339.3.peg.161 Staphylococcus aureus 04-02981 FIG   Capsular polysaccharide synthesis enzyme CapL
gb|AAC46095.1 Staphylococcus aureus     Cap5L
gb|ABQ47953.1 Staphylococcus aureus subsp. aureus JH9     glycosyl transferase, group 1
gb|ABR51013.1 Staphylococcus aureus subsp. aureus JH1     glycosyl transferase group 1
gb|EEV26337.1 Staphylococcus aureus A9781     glycosyl transferase
gb|EEV65035.1 Staphylococcus aureus A9763     glycosyl transferase
gb|EEV67003.1 Staphylococcus aureus A9719     glycosyl transferase group 1
gb|EEV71779.1 Staphylococcus aureus A9299     glycosyl transferase group 1
gb|EEV74349.1 Staphylococcus aureus A8115     glycosyl transferase group 1
gb|EEV76987.1 Staphylococcus aureus A6300     glycosyl transferase
gb|EEV80998.1 Staphylococcus aureus A6224     capsular polysaccharide synthesis enzyme Cap5L
gb|EEV84697.1 Staphylococcus aureus A5937     glycosyl transferase group 1
gi|13700076 Staphylococcus aureus subsp. aureus N315 NCBI   capsular polysaccharide synthesis enzyme Cap5L
gi|14245927 Staphylococcus aureus subsp. aureus Mu50 NCBI   capsular polysaccharide synthesis enzyme Cap5L
gi|147739655 Staphylococcus aureus subsp. aureus JH9 NCBI   glycosyl transferase, group 1
gi|148266586 Staphylococcus aureus subsp. aureus JH9 NCBI   glycosyl transferase, group 1
gi|149945077 Staphylococcus aureus subsp. aureus JH1 NCBI   glycosyl transferase group 1
gi|150392625 Staphylococcus aureus subsp. aureus JH1 NCBI   glycosyl transferase group 1
gi|156720625 Staphylococcus aureus subsp. aureus Mu3 NCBI   capsular polysaccharide synthesis enzyme Cap5L
gi|156978490 Staphylococcus aureus subsp. aureus Mu3 NCBI   capsular polysaccharide synthesis enzyme Cap5L
gi|15923150 Staphylococcus aureus subsp. aureus Mu50 NCBI   capsular polysaccharide synthesis enzyme Cap5L
gi|15925864 Staphylococcus aureus subsp. aureus N315 NCBI   capsular polysaccharide synthesis enzyme Cap5L
gi|1773351 Staphylococcus aureus NCBI   Cap5L
gi|253316308 Staphylococcus aureus subsp. aureus str. CF-Marseille NCBI   capsular polysaccharide synthesis enzyme Cap5L
gi|255004957 Staphylococcus aureus subsp. aureus Mu50-omega NCBI   capsular polysaccharide synthesis enzyme Cap5L
gi|257787997 Staphylococcus aureus A9781 NCBI   glycosyl transferase
gi|257794025 Staphylococcus aureus A9781 NCBI   glycosyl transferase
gi|257840576 Staphylococcus aureus A9763 NCBI   glycosyl transferase
gi|257842581 Staphylococcus aureus A9719 NCBI   glycosyl transferase group 1
gi|257847783 Staphylococcus aureus A9299 NCBI   glycosyl transferase group 1
gi|257850401 Staphylococcus aureus A8115 NCBI   glycosyl transferase group 1
gi|257854034 Staphylococcus aureus A6300 NCBI   glycosyl transferase
gi|257858110 Staphylococcus aureus A6224 NCBI   capsular polysaccharide synthesis enzyme Cap5L
gi|257861924 Staphylococcus aureus A5937 NCBI   glycosyl transferase group 1
gi|258408567 Staphylococcus aureus A9763 NCBI   glycosyl transferase
gi|258421157 Staphylococcus aureus A9719 NCBI   glycosyl transferase group 1
gi|258438907 Staphylococcus aureus A9299 NCBI   glycosyl transferase group 1
gi|258444142 Staphylococcus aureus A8115 NCBI   glycosyl transferase group 1
gi|258447021 Staphylococcus aureus A6300 NCBI   glycosyl transferase
gi|258448479 Staphylococcus aureus A6224 NCBI   capsular polysaccharide synthesis enzyme Cap5L
gi|258455712 Staphylococcus aureus A5937 NCBI   glycosyl transferase group 1
img|637091755 Staphylococcus aureus aureus N315 IMG   capsular polysaccharide synthesis enzyme Cap5L
img|637098659 Staphylococcus aureus aureus Mu50 IMG   capsular polysaccharide synthesis enzyme Cap5L
img|639108494 Staphylococcus aureus aureus JH1 IMG   Glycosyl transferase, group 1
img|640564476 Staphylococcus aureus aureus JH9 IMG   glycosyl transferase, group 1
img|640778221 Staphylococcus aureus aureus JH1 IMG   glycosyl transferase group 1
img|640902881 Staphylococcus aureus aureus Mu3 IMG   capsular polysaccharide synthesis enzyme Cap5L
kegg|sah:SaurJH1_0151 Staphylococcus aureus subsp. aureus JH1 KEGG   glycosyl transferase group 1
kegg|saj:SaurJH9_0146 Staphylococcus aureus subsp. aureus JH9 KEGG   glycosyl transferase, group 1
kegg|sau:SA0155   KEGG   capsular polysaccharide synthesis enzyme Cap5L
kegg|sav:SAV0160   KEGG   capsular polysaccharide synthesis enzyme Cap5L
kegg|saw:SAHV_0159 Staphylococcus aureus subsp. aureus Mu3 KEGG   capsular polysaccharide synthesis enzyme Cap5L
ref|NP_370684.1 Staphylococcus aureus subsp. aureus Mu50 RefSeq   capsular polysaccharide synthesis enzyme Cap5L
ref|NP_373397.1 Staphylococcus aureus subsp. aureus N315 RefSeq   capsular polysaccharide synthesis enzyme Cap5L
ref|YP_001245529.1 Staphylococcus aureus subsp. aureus JH9 RefSeq   glycosyl transferase, group 1
ref|YP_001315300.1 Staphylococcus aureus subsp. aureus JH1 RefSeq   glycosyl transferase group 1
ref|YP_001440749.1 Staphylococcus aureus subsp. aureus Mu3 RefSeq   capsular polysaccharide synthesis enzyme Cap5L
ref|ZP_04839521.1 Staphylococcus aureus subsp. aureus str. CF-Marseille RefSeq   capsular polysaccharide synthesis enzyme Cap5L
ref|ZP_05143558.2 Staphylococcus aureus subsp. aureus Mu50-omega RefSeq   capsular polysaccharide synthesis enzyme Cap5L
ref|ZP_05643004.1 Staphylococcus aureus A9781 RefSeq   glycosyl transferase
ref|ZP_05680852.1 Staphylococcus aureus A9763 RefSeq   glycosyl transferase
ref|ZP_05684084.1 Staphylococcus aureus A9719 RefSeq   glycosyl transferase group 1
ref|ZP_05689998.1 Staphylococcus aureus A9299 RefSeq   glycosyl transferase group 1
ref|ZP_05692476.1 Staphylococcus aureus A8115 RefSeq   glycosyl transferase group 1
ref|ZP_05695171.1 Staphylococcus aureus A6300 RefSeq   glycosyl transferase
ref|ZP_05696592.1 Staphylococcus aureus A6224 RefSeq   capsular polysaccharide synthesis enzyme Cap5L
ref|ZP_05703667.1 Staphylococcus aureus A5937 RefSeq   glycosyl transferase group 1
tr|A5IP30 Staphylococcus aureus (strain JH9) TrEMBL   Glycosyl transferase, group 1
tr|A6TXU5 Staphylococcus aureus (strain JH1) TrEMBL   Glycosyl transferase group 1
tr|A7WXD8 Staphylococcus aureus (strain Mu3 / ATCC 700698) TrEMBL   Capsular polysaccharide synthesis enzyme Cap5L
tr|P95705 Staphylococcus aureus TrEMBL   Cap5L
tr|Q7A2Y1 Staphylococcus aureus (strain Mu50 / ATCC 700699) TrEMBL   Capsular polysaccharide synthesis enzyme Cap5L
tr|Q7A832 Staphylococcus aureus (strain N315) TrEMBL   Capsular polysaccharide synthesis enzyme Cap5L


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function
15 fig|158879.11.peg.155 UDP-N-acetyl-L-fucosamine synthase (EC 5.1.3.28)
7 fig|158879.11.peg.157 Capsular polysaccharide synthesis enzyme CapI
6 fig|158879.11.peg.161 Capsular polysaccharide synthesis enzyme CapM


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search