The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|155920.4.peg.3350: Xylella fastidiosa subsp. sandyi Ann-1

This feature in The SEED Viewer

NCBI Taxonomy Id: 155920

Current Assignment: phage-related DNA polymerase
Translate Function Assignments



Context on contig NZ_AAAM03000044 from base 600 to 12924 (12325 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
3341 600 1061 462 +           conserved hypothetical protein locus|XfasoDRAFT_2197, protein_id|ZP_00682450.1, gi|71900315
3342 1058 1465 408 + -4         FIG01217517: hypothetical protein locus|XfasoDRAFT_2198, protein_id|ZP_00682451.1, gi|71900316
3343 1462 1653 192 + -4         FIG01218187: hypothetical protein locus|XfasoDRAFT_2199, protein_id|ZP_00682452.1, gi|71900317
3344 1677 1868 192 + 23         conserved hypothetical protein locus|XfasoDRAFT_2227, protein_id|ZP_00682480.1, gi|71900345
3345 1900 2094 195 + 31         FIG01217231: hypothetical protein locus|XfasoDRAFT_2228, protein_id|ZP_00682481.1, gi|71900346
3346 2151 2582 432 + 56         FIG01217753: hypothetical protein locus|XfasoDRAFT_2200, protein_id|ZP_00682453.1, gi|71900318
3347 2594 3856 1263 + 11 12     Phage protein locus|XfasoDRAFT_2201, protein_id|ZP_00682454.1, gi|71900319
3348 3856 4422 567 + -1 11     Phage protein locus|XfasoDRAFT_2202, protein_id|ZP_00682455.1, gi|71900320
3349 4491 5657 1167 + 68         Phage antirepressor protein locus|XfasoDRAFT_2203, protein_id|ZP_00682456.1, gi|71900321, InterPro:IPR003497
3350 5659 7839 2181 + 1       phage-related DNA polymerase locus|XfasoDRAFT_2204, protein_id|ZP_00682457.1, gi|71900322, InterPro:IPR001098
3351 7836 8114 279 + -4 6     Phage protein locus|XfasoDRAFT_2205, protein_id|ZP_00682458.1, gi|71900323
3352 8442 8116 327 - 1         Phage protein locus|XfasoDRAFT_2206, protein_id|ZP_00682459.1, gi|71900324
3353 8527 9945 1419 + 84 10     DNA helicase, phage-associated locus|XfasoDRAFT_2207, protein_id|ZP_00682460.1, gi|71900325, InterPro:IPR000330, InterPro:IPR000566, InterPro:IPR001410
3354 9958 10182 225 + 12         hypothetical protein  
rna.54 11519 11445 75 - 1262     1: 3   tRNA-Val-CAC  
3356 11848 11579 270 - 59         Type IV pilus biogenesis protein PilZ locus|XfasoDRAFT_2209, protein_id|ZP_00682462.1, gi|71900327, InterPro:IPR009875
3357 12924 11932 993 - 83     2: 1 2   DNA polymerase III delta prime subunit (EC 2.7.7.7) locus|XfasoDRAFT_2210, protein_id|ZP_00682463.1, gi|71900328, InterPro:IPR000449, InterPro:IPR003439

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|155920.4.peg.3350 phage-related DNA polymerase
MATAQPPAPILWGDLETYSPVPIAHGVHAYAEQAELLLFAYAIGNGPVQVWDCTATATMP
EELSAALHNPAVLLYFHNSHFDRTVLRHCGIDIPLERWRDSMAQALAHSLPGALGTLCEL
LRVPVEQAKAKDGKRLVALFCKPRPAHCTLRRATRDTHPTEWAQFVEYARRDVAAMRDVV
KRLPSHNYTGAELALWFLDQTINDRGVMVDTDLAQAAIGAVERAKQALAERTSDLTAGVV
QAATQRDALLHHLSTEHGVALPDMQQHTVERCLDDPLLPETVRELLSIRRQASTTSTAKY
QALLNCTSGDGRLRGTLQFNGASRTGRWAGRLFQPHNLPRPTLSQPVIAVGIDAMKAGCV
DLVFDDVMALTSSALRSCLIAPTHKKLVVADLSNIEGRVLAWLAGETPKLHAFRDFDTCQ
GVDGTWHSGEAITHGALRGAPITLQRNAEHEPIRQGDDIYKRAYAHSFGIAPQAVTKEQR
QIGKVQELALGYGGGVGAFAAFAAMYHIDLEAMAEQAALPPLLLQEAVEALQWTKANQRP
TFGLSDRAWLACDVFKRAWRNAHPAIAAFWKALQFAATDAIRHPETAHTCCGITMQYSRA
WLRMHLPSGRVLYYAAPRVDEHGALSYMGTHPMTRKWTRITTYGGKLVENITQAVSRDVL
AACMPAIEAAGYQIVLTVHDEIITEADDNAAFNAAHLAALMATPPPWAQGLPLAAEGFQT
HRYRKQ

MD5 = 682e295f671df9fa741ab838d8367bb8


  DNA Sequence

>fig|155920.4.peg.3350 phage-related DNA polymerase
atggctaccgcgcagccacccgcacccatcctatggggggacctagagacgtactccccc
gtaccgattgcccatggcgtgcatgcgtatgccgagcaagccgagctgttgctgtttgct
tacgcgatcggcaacggtccggtgcaggtgtgggactgcacagccacggcaacgatgcct
gaggagctgtcggctgcgttgcacaaccccgcggtgctgctgtacttccacaactcccat
tttgaccgaaccgtgctacgccattgcggcatcgacatccccttggagcgctggcgcgat
tcgatggcccaggccttggcccattcgctgcctggggcgctaggcacgttatgcgagctg
ctgcgcgttcctgtggagcaagccaaggccaaggacggcaaacggctcgttgcactgttt
tgcaaaccgcgccccgcccactgcacgttgcgccgtgccacacgtgacacccatccgacc
gagtgggcgcagtttgtggagtacgccaggcgcgatgtggcagccatgcgggacgtggtg
aagcgcttgccgtcccacaactacacgggggcggagctggcgctgtggtttctggaccaa
actattaatgaccgaggcgttatggtcgatacagacttagcccaggccgccatcggcgct
gtggaacgcgccaagcaagcactggccgagcgcaccagtgacctcacagcaggagtggtg
caggcggcgacccagcgcgatgcactgttgcaccacctgagcaccgagcacggcgtggcg
ttgccggacatgcagcaacacacggtagagcgttgtcttgacgatccgctgttgccagag
acggtgcgggaactgctgtccatccgcaggcaagccagcaccaccagcaccgctaagtat
caggcgctgctgaactgcaccagtggcgatggccgtctgcgcggcacactgcaatttaac
ggggccagccgcaccggacgttgggcggggcggctgtttcagccgcacaacctgccccgc
cccacgctcagccagccagtgatcgcggttggcattgatgccatgaaagccggttgtgtg
gatttggtctttgacgatgtcatggcgctgaccagcagcgcgctacgcagttgtctgatt
gcgccaacacataaaaagctggtcgtggccgatctgtccaacattgaaggccgcgtgttg
gcgtggctggccggtgaaacccccaagctgcacgcgtttcgtgattttgatacgtgccaa
ggggtggacggtacatggcacagcggcgaggccatcactcacggtgcgctgcgcggcgcg
ccaatcaccctgcaacgtaatgccgagcacgagcctatccgccaaggggacgacatttac
aagcgcgcctacgctcattcgttcgggatagcgccccaggccgtgaccaaggagcaacgc
cagattggcaaagtgcaggaattggcattggggtatggcggcggtgtcggggcctttgcc
gcctttgcggccatgtatcacatagatttggaggcgatggccgagcaggccgccttacca
cccctgctgcttcaggaggccgtggaagcgctccagtggacgaaggcgaaccaacgtccc
actttcggcctctcagatcgcgcatggttggcgtgcgatgtgtttaagcgcgcatggcgc
aacgcgcatccggccattgcggcgttttggaaggcgttgcagttcgcggccacagacgcc
atccgccaccccgaaacggcgcacacctgctgcggtatcacaatgcagtacagccgtgca
tggctgcggatgcatctgccgtcggggcgggtgctttactacgccgctcccagagtcgat
gagcacggcgcgctgtcctacatgggcacgcatccgatgacgcgaaaatggacgcgcatc
accacctacggcggcaagctggtcgagaacatcacccaagccgtcagccgcgacgtgttg
gccgcctgcatgcctgcgattgaagcagcggggtatcagatcgttttaaccgtgcacgac
gaaattattaccgaagccgatgacaacgccgctttcaatgccgcgcacttggccgcactc
atggcgacaccgccgccctgggcgcaggggttgcccttagcggcggaaggcttccaaacc
caccggtataggaagcaatga


  DNA with Flanking Sequence

>fig|155920.4.peg.3350 phage-related DNA polymerase
caagcgttttaagcgttgggtgacgagcgaagtcctgcccaccctgcgcaagacaggcac
ctactccacaccaggagcactgcccaccttgcctgggccgacacaggatcgcattgccgc
actcctattaatcggccaatacatctccacagtgccaggggtgaagccagggattgccgc
agcggcaacgctggcctgcatcaaaagcaatacgaatttaacgaccgaagagatacgccg
tgcgttgcctgcactgcgggacccgctttgcatgctcaacgccacgcaactaggtaagca
gctgcattgctcggccaaggcggcgaaccaattattagcctccagtggctttcagttccg
taatgaacgcgacgcgtgggaattaaccgaagccggtcgcgtggggggtgaagcgattcc
gtactcacgcaacgggcacagcagctaccaaattctttggaacccaacggtgcttgactc
gctgaaggtagccgcctgagatggctaccgcgcagccacccgcacccatcctatgggggg
acctagagacgtactcccccgtaccgattgcccatggcgtgcatgcgtatgccgagcaag
ccgagctgttgctgtttgcttacgcgatcggcaacggtccggtgcaggtgtgggactgca
cagccacggcaacgatgcctgaggagctgtcggctgcgttgcacaaccccgcggtgctgc
tgtacttccacaactcccattttgaccgaaccgtgctacgccattgcggcatcgacatcc
ccttggagcgctggcgcgattcgatggcccaggccttggcccattcgctgcctggggcgc
taggcacgttatgcgagctgctgcgcgttcctgtggagcaagccaaggccaaggacggca
aacggctcgttgcactgttttgcaaaccgcgccccgcccactgcacgttgcgccgtgcca
cacgtgacacccatccgaccgagtgggcgcagtttgtggagtacgccaggcgcgatgtgg
cagccatgcgggacgtggtgaagcgcttgccgtcccacaactacacgggggcggagctgg
cgctgtggtttctggaccaaactattaatgaccgaggcgttatggtcgatacagacttag
cccaggccgccatcggcgctgtggaacgcgccaagcaagcactggccgagcgcaccagtg
acctcacagcaggagtggtgcaggcggcgacccagcgcgatgcactgttgcaccacctga
gcaccgagcacggcgtggcgttgccggacatgcagcaacacacggtagagcgttgtcttg
acgatccgctgttgccagagacggtgcgggaactgctgtccatccgcaggcaagccagca
ccaccagcaccgctaagtatcaggcgctgctgaactgcaccagtggcgatggccgtctgc
gcggcacactgcaatttaacggggccagccgcaccggacgttgggcggggcggctgtttc
agccgcacaacctgccccgccccacgctcagccagccagtgatcgcggttggcattgatg
ccatgaaagccggttgtgtggatttggtctttgacgatgtcatggcgctgaccagcagcg
cgctacgcagttgtctgattgcgccaacacataaaaagctggtcgtggccgatctgtcca
acattgaaggccgcgtgttggcgtggctggccggtgaaacccccaagctgcacgcgtttc
gtgattttgatacgtgccaaggggtggacggtacatggcacagcggcgaggccatcactc
acggtgcgctgcgcggcgcgccaatcaccctgcaacgtaatgccgagcacgagcctatcc
gccaaggggacgacatttacaagcgcgcctacgctcattcgttcgggatagcgccccagg
ccgtgaccaaggagcaacgccagattggcaaagtgcaggaattggcattggggtatggcg
gcggtgtcggggcctttgccgcctttgcggccatgtatcacatagatttggaggcgatgg
ccgagcaggccgccttaccacccctgctgcttcaggaggccgtggaagcgctccagtgga
cgaaggcgaaccaacgtcccactttcggcctctcagatcgcgcatggttggcgtgcgatg
tgtttaagcgcgcatggcgcaacgcgcatccggccattgcggcgttttggaaggcgttgc
agttcgcggccacagacgccatccgccaccccgaaacggcgcacacctgctgcggtatca
caatgcagtacagccgtgcatggctgcggatgcatctgccgtcggggcgggtgctttact
acgccgctcccagagtcgatgagcacggcgcgctgtcctacatgggcacgcatccgatga
cgcgaaaatggacgcgcatcaccacctacggcggcaagctggtcgagaacatcacccaag
ccgtcagccgcgacgtgttggccgcctgcatgcctgcgattgaagcagcggggtatcaga
tcgttttaaccgtgcacgacgaaattattaccgaagccgatgacaacgccgctttcaatg
ccgcgcacttggccgcactcatggcgacaccgccgccctgggcgcaggggttgcccttag
cggcggaaggcttccaaacccaccggtataggaagcaatgatgaacatcccccgtgagcg
gacgatcgaacgctatttagtggcccaggtcagggccaagggcggtgaaatccgcaaggt
gaaatggggtggccgccacggtgcgccggaccgtatcgccatgctgcccgaggggcgcac
cctgtgggtggaactcaaagccccaggtcagcagtgcacaccgcatcaagtccgtgagca
tgagcgcctgcgtcgcatgggccagcgcgtggtcgtggtcgattcctttaaaggcgtgga
tgaggtgctggcgtgactcagaaaaacgctttgatgatcagtgccaccaggctagtgacg
atcacaccgaacatccattttagtagcagcatttcgccttttatttcagcgaacccttta
tgtacatcaacgaaccctttatgtacatcagcgaaccctttatctatttttgattcgagc
tttaattccagctcccgcaaatctcgctttgtcgcaaggtcttgcaaattcgtttctagc
a


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0003676       F:nucleic acid binding
GO:0003887       F:DNA-directed DNA polymerase activity
fig|155919.4.peg.2323 Xylella fastidiosa Dixon FIG   phage-related DNA polymerase
gb|EAO12599.1 Xylella fastidiosa Dixon     DNA-directed DNA polymerase
gb|EAO31993.1 Xylella fastidiosa Ann-1     DNA-directed DNA polymerase
gi|71162875 Xylella fastidiosa Dixon NCBI   DNA-directed DNA polymerase
gi|71276267 Xylella fastidiosa Dixon NCBI   DNA-directed DNA polymerase
gi|71729897 Xylella fastidiosa Ann-1 NCBI   DNA-directed DNA polymerase
gi|71900322 Xylella fastidiosa Ann-1 NCBI   DNA-directed DNA polymerase
img|638354998 Xylella fastidiosa Dixon IMG   DNA-directed DNA polymerase
img|638358243 Xylella fastidiosa Ann-1 IMG   DNA-directed DNA polymerase
ref|ZP_00652545.1 Xylella fastidiosa Dixon RefSeq   DNA-directed DNA polymerase
ref|ZP_00682457.1 Xylella fastidiosa Ann-1 RefSeq   DNA-directed DNA polymerase
tr|Q3R448 Xylella fastidiosa Ann-1 TrEMBL   DNA-directed DNA polymerase
tr|Q3RD81 Xylella fastidiosa Dixon TrEMBL   DNA-directed DNA polymerase


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function
12 fig|155920.4.peg.3347 Phage protein
11 fig|155920.4.peg.3348 Phage protein
6 fig|155920.4.peg.3351 Phage protein
10 fig|155920.4.peg.3353 DNA helicase, phage-associated


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search