The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|155920.4.peg.3347: Xylella fastidiosa subsp. sandyi Ann-1

This feature in The SEED Viewer

NCBI Taxonomy Id: 155920

Current Assignment: Phage protein
Translate Function Assignments



Context on contig NZ_AAAM03000044 from base 271 to 9945 (9675 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
3340 271 603 333 +           hypothetical protein locus|XfasoDRAFT_2196, protein_id|ZP_00682449.1, gi|71900314
3341 600 1061 462 + -4         conserved hypothetical protein locus|XfasoDRAFT_2197, protein_id|ZP_00682450.1, gi|71900315
3342 1058 1465 408 + -4         FIG01217517: hypothetical protein locus|XfasoDRAFT_2198, protein_id|ZP_00682451.1, gi|71900316
3343 1462 1653 192 + -4         FIG01218187: hypothetical protein locus|XfasoDRAFT_2199, protein_id|ZP_00682452.1, gi|71900317
3344 1677 1868 192 + 23         conserved hypothetical protein locus|XfasoDRAFT_2227, protein_id|ZP_00682480.1, gi|71900345
3345 1900 2094 195 + 31         FIG01217231: hypothetical protein locus|XfasoDRAFT_2228, protein_id|ZP_00682481.1, gi|71900346
3346 2151 2582 432 + 56         FIG01217753: hypothetical protein locus|XfasoDRAFT_2200, protein_id|ZP_00682453.1, gi|71900318
3347 2594 3856 1263 + 11       Phage protein locus|XfasoDRAFT_2201, protein_id|ZP_00682454.1, gi|71900319
3348 3856 4422 567 + -1 10     Phage protein locus|XfasoDRAFT_2202, protein_id|ZP_00682455.1, gi|71900320
3349 4491 5657 1167 + 68         Phage antirepressor protein locus|XfasoDRAFT_2203, protein_id|ZP_00682456.1, gi|71900321, InterPro:IPR003497
3350 5659 7839 2181 + 1 15     phage-related DNA polymerase locus|XfasoDRAFT_2204, protein_id|ZP_00682457.1, gi|71900322, InterPro:IPR001098
3351 7836 8114 279 + -4         Phage protein locus|XfasoDRAFT_2205, protein_id|ZP_00682458.1, gi|71900323
3352 8442 8116 327 - 1         Phage protein locus|XfasoDRAFT_2206, protein_id|ZP_00682459.1, gi|71900324
3353 8527 9945 1419 + 84         DNA helicase, phage-associated locus|XfasoDRAFT_2207, protein_id|ZP_00682460.1, gi|71900325, InterPro:IPR000330, InterPro:IPR000566, InterPro:IPR001410

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|155920.4.peg.3347 Phage protein
MLSPSSAHRWLHCPASVPLTRTCKDDASPFADEGTVAHTVAADALRTGCDASAYVGECHE
VNGHRWEVTAEMAAYVQEYVDYVRAIAGVRLVEQPLRIASITREQGAKGTADVVILAGDE
LTIVDLKYGRGVKVFAEGNEQLQLYALAALQEFAGLEAFQHVRLVIVQPRLGHADEWVRT
LPQMEDFRRKVAQGAARCRAAMWHYNNVGELPSEYFGPAEKPCRFCKAKASCPALATHVL
NTVADDFVDLTKPIVPQLSYAALRTFDNTTLACLFGATELIESWCKSIRDRAAAELLSGQ
PVPGYKVVQGRHGPRRWVDETAAEDALKQLRIKFKDMYDVSLISPTRAEKLYQAGVIGDR
QWPKLQPLIHRAAGTPVVVPTSDKRPPLALQDATDFQDLSDMPIPPLPDTAPSLQSQETP

MD5 = 19a050d043e154605c867bbc283751aa


  DNA Sequence

>fig|155920.4.peg.3347 Phage protein
atgttatccccgagcagtgcgcatcgttggttgcactgtccggcaagcgttccgttaacg
cgcacctgcaaagacgacgctagcccatttgccgatgaaggcaccgtggcccatacggtg
gctgccgacgcattacgcaccggctgcgatgccagcgcgtacgtgggggaatgccatgag
gtaaacggccaccgctgggaagtcaccgcagagatggcggcgtacgtgcaggagtatgtg
gactatgtacgcgccattgcgggggtgcgcctggtcgagcagcccctacgcattgcctcc
attactagggagcaaggcgctaaaggcaccgctgatgtggtgattttagcgggggatgag
ctaaccatcgttgatctcaaatacggcagaggagtcaaagtcttcgccgaaggcaatgag
caattgcagctatatgcgctggcagcgctgcaagaatttgcagggctggaagccttccag
cacgtgcggctagtgatcgtgcaaccacggctcggacatgccgatgagtgggtgcgcacc
ctcccccagatggaggattttaggcggaaagttgcgcaaggcgcggcgcggtgtagggct
gcgatgtggcactacaacaacgtaggcgaattaccttcagagtatttcggccccgcagaa
aaaccatgccgattttgcaaggccaaagcgagctgccctgcgttggccacgcatgtactg
aacacggtggcagatgattttgtcgacctcacaaagcccattgtcccgcagctcagctac
gcggccctgcgcacgtttgacaacaccacgctggcctgcctgtttggcgcaacagagtta
atcgaatcctggtgcaaatctattcgcgacagggcggcagcggagttgctttcaggccag
cccgtgcctggatacaaggtggttcaaggccgacacgggccgcgccgttgggtggatgag
acagccgccgaggacgcgctcaaacagctgcgcatcaaattcaaagacatgtacgacgtg
tctctcatcagccccacgcgtgccgagaaactctaccaggccggagtcattggtgatcgc
cagtggccaaagctccaaccgctcattcatagggcagcagggacgcccgttgttgttccc
acatcggataaacgccccccgctcgcccttcaagacgcgacggatttccaggacttgagc
gacatgcccatccccccactcccagacacagcaccctcacttcaatctcaggagacaccg
taa


  DNA with Flanking Sequence

>fig|155920.4.peg.3347 Phage protein
atgacaacggacaacacatcggaacggaacaacccacacacgagagaaaaaaaacccatg
tttcctatcaccgtcacgattaccgatcaggcccaattaaacgctgtgttagcggtgctt
aacccgccccgcagcacgagcagccccgcgcaacctgtgtttgacgatacaccgcgcagc
gataacgcccctagccctccaccggcggcacctcctcccccaacggatgtggcgcaaccg
gcggccaaccctgctgctgctcagagcacaacggacgttatgagcacgcctgggtatctt
gaggcggcgaaggcgttaacggccctgtctaaagagcttggcaatacatacgccaaagac
gtgttgaagtcatttggcgtggctggcctctctcaaatccctccggagttgtacccaacg
ctgatggagcgcatcgaaggattttacatcgcccacgaacgcggtttgcccttagacggt
gagacatgagccagcacgccatgttatccccgagcagtgcgcatcgttggttgcactgtc
cggcaagcgttccgttaacgcgcacctgcaaagacgacgctagcccatttgccgatgaag
gcaccgtggcccatacggtggctgccgacgcattacgcaccggctgcgatgccagcgcgt
acgtgggggaatgccatgaggtaaacggccaccgctgggaagtcaccgcagagatggcgg
cgtacgtgcaggagtatgtggactatgtacgcgccattgcgggggtgcgcctggtcgagc
agcccctacgcattgcctccattactagggagcaaggcgctaaaggcaccgctgatgtgg
tgattttagcgggggatgagctaaccatcgttgatctcaaatacggcagaggagtcaaag
tcttcgccgaaggcaatgagcaattgcagctatatgcgctggcagcgctgcaagaatttg
cagggctggaagccttccagcacgtgcggctagtgatcgtgcaaccacggctcggacatg
ccgatgagtgggtgcgcaccctcccccagatggaggattttaggcggaaagttgcgcaag
gcgcggcgcggtgtagggctgcgatgtggcactacaacaacgtaggcgaattaccttcag
agtatttcggccccgcagaaaaaccatgccgattttgcaaggccaaagcgagctgccctg
cgttggccacgcatgtactgaacacggtggcagatgattttgtcgacctcacaaagccca
ttgtcccgcagctcagctacgcggccctgcgcacgtttgacaacaccacgctggcctgcc
tgtttggcgcaacagagttaatcgaatcctggtgcaaatctattcgcgacagggcggcag
cggagttgctttcaggccagcccgtgcctggatacaaggtggttcaaggccgacacgggc
cgcgccgttgggtggatgagacagccgccgaggacgcgctcaaacagctgcgcatcaaat
tcaaagacatgtacgacgtgtctctcatcagccccacgcgtgccgagaaactctaccagg
ccggagtcattggtgatcgccagtggccaaagctccaaccgctcattcatagggcagcag
ggacgcccgttgttgttcccacatcggataaacgccccccgctcgcccttcaagacgcga
cggatttccaggacttgagcgacatgcccatccccccactcccagacacagcaccctcac
ttcaatctcaggagacaccgtaatgaaactcaccctaaaaaacgtgcgcttagccttccc
cgtgttgtttgaacccaagaaagtcaatggcgaaggcgaggccgcattctcggcctgctt
cctgattgaccctgccgacccgcaagtcaaagcccttaaccaggccattgacaagatggc
caatgacaaatggggcgttaaggcggcggctcagcttaaacagatgcgtatgggcgacag
agtcgccttgcatgatggcgacctgaaagccagctatgacgggtttgcagggcacctata
cgtctctgcgcgtaacaagtcacggccactggtggtcgaccgtgaccggaccccgctcac
cgcgcaggacggcaggccgtatgccggatgttacgtcaacgccaacatagaactctgggc
gcaggacaacaactacggcaagcggattaacgcctcactgggtggcgtgcagttcctgcg
tgatggcgaggcgttcgctggaggcggtgtggccagcgtggag


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
fig|155919.4.peg.2320 Xylella fastidiosa Dixon FIG   Phage protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function
10 fig|155920.4.peg.3348 Phage protein
15 fig|155920.4.peg.3350 phage-related DNA polymerase


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


Tool Description
General Tools
Psi-Blast NCBI's psi-blast is used to locate distant similarities
Transmembrane Predictions
TMpred Tool for Predicting Transmembrane regions
TMHMM Prediction of transmembrane helices in proteins
Protein Signals for Gram negative bacteria
Gram negative PSORT Prediction of protein localization sites
Gram negative SignalP Predicts the presence and location of signal peptide cleavage sites
Protein Signals for Gram positive bacteria
Gram positive PSORT Prediction of protein localization sites
Gram positive SignalP Predicts the presence and location of signal peptide cleavage sites
Other useful tools
LipoP Prediction of lipoproteins and signal peptides in Gram negative bacteria
Radar Rapid Automatic Detection and Alignment of Repeats in protein sequences
PPSearch Search for protein motifs against all patterns stored in the PROSITE pattern database
Gram negative CELLO Subcellular localization predictor at National Chiao Tung University
Gram positive CELLO Subcellular localization predictor at National Chiao Tung University
ProDom A comprehensive set of protein domain families automatically generated from the SWISS-PROT and TrEMBL sequence databases
PDB An Information Portal to Biological Macromolecular Structures
For Specific Organisms
RNAFold The RNAfold web server will predict secondary structures of single stranded RNA or DNA sequences.

< Hide tool descriptions


FIG search