The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|155920.1.peg.850: Xylella fastidiosa Ann-1

This feature in The SEED Viewer

NCBI Taxonomy Id: 155920

Current Assignment: Phage recombination protein Bet
Translate Function Assignments



Context on contig NZ_AAAM01000038 from base 44654 to 50229 (5576 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
845 45631 44654 978 -           Phage integrase XfasO0859, ZP_00041055.1, gi|22996811, COG: COG0582
846 46308 45865 444 - 233     4: 1 2 4 3 ff
idu(6)
idu(6)
idu(6)
ilit(
8063092)
Phage ssDNA binding protein XfasO0860, ZP_00041056.1, gi|22996812, COG: COG0629
847 47079 46366 714 - 57         Phage DNA-binding antirepressor protein Roi XfasO0861, ZP_00041057.1, gi|22996813, COG: COG3646
848 48038 47076 963 - -4         Phage DNA-binding antirepressor protein Roi XfasO0862, ZP_00041058.1, gi|22996814, COG: COG3617
849 49669 48035 1635 - -4 4     Phage protein XfasO0863, ZP_00041059.1, gi|22996815
850 50229 49666 564 - -4       Phage recombination protein Bet XfasO0864, ZP_00041060.1, gi|22996816

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|155920.1.peg.850 Phage recombination protein Bet
PERYLSWCRIAVYRMVAGERVRFAATVYWLEAYATARKDSPAPNSMWQKRPFGQLEKCAE
ALALRKAFPEAVGAQPTAEEMDAGRHTIEGETIHAAPIPVNKDIREISGPYPQEEFEKNF
PKWCDLIESGKTTADRIITMLHSKDKGQLTPEQLTAIRACAEDTSAEPVPTDNIPQESNT
THTEENT

MD5 = b38b02539bc7def26854d793ed3a213e


  DNA Sequence

>fig|155920.1.peg.850 Phage recombination protein Bet
ccagaacgctatctgtcatggtgccgcattgcggtgtaccgcatggttgctggtgaacgc
gtccggtttgccgcaaccgtgtattggctggaagcctatgccaccgcaagaaaagacagc
cccgcccctaacagcatgtggcaaaaacgtccctttggacagttggagaaatgcgctgaa
gccttggcattacgtaaggcattcccagaagccgtgggcgctcaaccgacggctgaggaa
atggatgccggacgacacacgattgagggcgaaacgatccatgctgctcccatccccgtt
aacaaagacatcagagaaatcagcggcccttacccacaagaagaatttgaaaagaatttt
ccaaaatggtgtgacctgattgaatcaggaaaaaccacggcagatcgcatcatcacgatg
ctgcatagcaaagacaaaggccaattaaccccagagcaactcaccgccattcgcgcctgc
gcagaagacaccagtgctgagcctgtgcctacagacaacatcccacaggaaagcaacacc
actcacacggaagaaaacacatga


  DNA with Flanking Sequence

>fig|155920.1.peg.850 Phage recombination protein Bet
tgaccagaacgctatctgtcatggtgccgcattgcggtgtaccgcatggttgctggtgaa
cgcgtccggtttgccgcaaccgtgtattggctggaagcctatgccaccgcaagaaaagac
agccccgcccctaacagcatgtggcaaaaacgtccctttggacagttggagaaatgcgct
gaagccttggcattacgtaaggcattcccagaagccgtgggcgctcaaccgacggctgag
gaaatggatgccggacgacacacgattgagggcgaaacgatccatgctgctcccatcccc
gttaacaaagacatcagagaaatcagcggcccttacccacaagaagaatttgaaaagaat
tttccaaaatggtgtgacctgattgaatcaggaaaaaccacggcagatcgcatcatcacg
atgctgcatagcaaagacaaaggccaattaaccccagagcaactcaccgccattcgcgcc
tgcgcagaagacaccagtgctgagcctgtgcctacagacaacatcccacaggaaagcaac
accactcacacggaagaaaacacatgaacatcattgaactgacccaaggcaccccgcaat
ggcacacccaccgcgcccagtatctcaatgccagcgacgcaccggccatgatgggatgca
gcccctataaaagccgtgccgaaccgatacgggaacgcgccacggggatcacccccgact
atgaccaagccacgttacaacgttttgctgagggtcatcgcgttgaagaactggcacgcc
ccttggcagaacgcatcatcggtgatgacctgtatccctgtgttggtgtcgatgacatgt
attcggccagcttcgacggcttgaccttgctggaagacaccgtctgggaacacaagcaac
tcaatgacacgattcgcgccgccatgacagacggcagcaccggccaagacctgccattac
attatcaaatacagatggaacaccagagcatggtgtccggtgcccaacgtgtcctgttca
tggcctcggcctggaacggtgaacagctcatagaagaacgtcattgc


  Assignments for Essentially Identical Proteins

No essentially identical proteins found

  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function
4 fig|155920.1.peg.849 Phage protein


  Attributes

Help on Attributes

Key
Link Explains Key
Value
IPR::IPR004590_interpro_download 84.8;7-105
isoelectric_point 4.98
molecular_weight 20990
PFAM::PF03837_interpro_download 84.8;7-105
PSORT::unknown unknown
similar_to_human no


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search