The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|155920.1.peg.848: Xylella fastidiosa Ann-1

This feature in The SEED Viewer

NCBI Taxonomy Id: 155920

Current Assignment: Phage DNA-binding antirepressor protein Roi
Translate Function Assignments



Context on contig NZ_AAAM01000038 from base 39369 to 50229 (10861 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
844 39369 43934 4566 +       2: 1 2 ff
icw(4)
Type IV fimbrial biogenesis protein PilY1 XfasO0858, ZP_00041054.1, gi|22996810, COG: COG3419
2173 43931 44386 456 + -4     2: 1 2 ff
icw(1)
ilit(
3141743)
ilit(9515697)
Type IV pilus biogenesis protein PilE  
rna.020 44491 44567 77 + 104         tRNA-Asn-GTT tRNA-Asn-GTT
845 45631 44654 978 - 86         Phage integrase XfasO0859, ZP_00041055.1, gi|22996811, COG: COG0582
846 46308 45865 444 - 233     4: 3 4 6 5 ff
idu(6)
idu(6)
idu(6)
ilit(
8063092)
Phage ssDNA binding protein XfasO0860, ZP_00041056.1, gi|22996812, COG: COG0629
847 47079 46366 714 - 57         Phage DNA-binding antirepressor protein Roi XfasO0861, ZP_00041057.1, gi|22996813, COG: COG3646
848 48038 47076 963 - -4         Phage DNA-binding antirepressor protein Roi XfasO0862, ZP_00041058.1, gi|22996814, COG: COG3617
849 49669 48035 1635 - -4         Phage protein XfasO0863, ZP_00041059.1, gi|22996815
850 50229 49666 564 - -4         Phage recombination protein Bet XfasO0864, ZP_00041060.1, gi|22996816

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|155920.1.peg.848 Phage DNA-binding antirepressor protein Roi
MMTGAANITSHVMNGTFDDRVLGNLDSRYGPSLTTAHRCGTLAGKECKDSESSGYRTRQS
RGFFVPGSMTMAGRATDKKPRKGEEVHRLLSVFNLPATQRRRVKTTSLRFSNLSRSRHMS
VPSVIPFSFENHPVRVLIINGEPWFVAKDLCAVLHIVNSRSALIALDETEKGVGSTDTLG
GQQELAIVNESGMWTLVLRCRDAVKPGTVPYRVRKWITGEVLPSIRKTGSYTATGTMVND
DALCAIWFLCDHFKKLHEMSRVNKVPQALYWLGATEISGELGTRLLEGMRGGVLKIEKAL
GPHMEQAAQKGMGNASRHLS

MD5 = dacb429795864b7050d6ae9eac81aae4


  DNA Sequence

>fig|155920.1.peg.848 Phage DNA-binding antirepressor protein Roi
gtgatgacaggggcagccaatatcacgagccatgtcatgaacggcacgtttgatgatcgc
gttctcggcaatctcgattccagatacggcccgagcttgaccactgcccaccgctgcggt
accctcgccggtaaggagtgtaaagactccgaaagcagcggttaccgcacccgtcagtct
cgcggtttttttgtgcccggctccatgactatggccgggagggcgacggataaaaaaccc
cgcaagggggaagaagtccaccgactgctttcggtctttaacctcccggccacccagcgg
aggcgtgtaaagacgacttcgctgaggttttcaaacttaagcaggagtcgccacatgtcc
gtaccctctgttattccgttctcatttgagaatcatcctgttcgcgttctcatcatcaac
ggagaaccttggttcgttgcaaaagacctatgcgcagtactgcacatcgttaattccagg
tccgcattaattgcattagatgaaactgaaaagggagtaggttcaaccgacacccttggc
ggccaacaggaactagccatcgtcaacgagtccggcatgtggacactagtcctacgctgc
cgtgatgccgtcaagccgggaactgtcccctaccgcgtccgcaaatggatcacaggcgaa
gtccttccctcgatccgcaagacgggcagttataccgccacgggaacaatggtgaatgac
gatgcactctgcgccatctggtttctgtgcgaccacttcaagaagctgcacgagatgtcc
cgcgtcaataaggttccgcaagcactgtattggcttggagcgacagagattagcggtgag
cttggtacgcgtctgcttgagggcatgaggggcggcgttctcaaaatagaaaaagccctc
ggcccacacatggaacaggccgcccaaaagggcatgggcaatgcaagcaggcatctgtca
tga


  DNA with Flanking Sequence

>fig|155920.1.peg.848 Phage DNA-binding antirepressor protein Roi
aagatcaacatcactgcccacgtggaacgggtgcgcgccaatatcaccgtgatggaagca
tgtgacgcggcttaccgctccctgtttccagacagggtgagtctatgcatcagcaaaaca
cccgatgacctgcgcaatctgatccttgcccgcattgccgatcatcagcagcaggaacag
gcacgcatccaagctcaacgcgagcgccagaacaccgtcgaagcaacgccattacccacc
tcgccaacagcccactgctccaccgaatccactgcaaccaccccagcatccacaggccac
ctcatcaagctgggcgatatcaatgcattgattgccccactatccatcaatgccgatgga
ttagcagcactgggttttgtccccatcggcaccgaacgcgccaccaagtggtacgccgct
gctgaatttcctgtgatctgtcatgccttgaaacaggtgttgtccaacgcttcatcccgc
accgccatcaagcaggccgcgtgatgacaggggcagccaatatcacgagccatgtcatga
acggcacgtttgatgatcgcgttctcggcaatctcgattccagatacggcccgagcttga
ccactgcccaccgctgcggtaccctcgccggtaaggagtgtaaagactccgaaagcagcg
gttaccgcacccgtcagtctcgcggtttttttgtgcccggctccatgactatggccggga
gggcgacggataaaaaaccccgcaagggggaagaagtccaccgactgctttcggtcttta
acctcccggccacccagcggaggcgtgtaaagacgacttcgctgaggttttcaaacttaa
gcaggagtcgccacatgtccgtaccctctgttattccgttctcatttgagaatcatcctg
ttcgcgttctcatcatcaacggagaaccttggttcgttgcaaaagacctatgcgcagtac
tgcacatcgttaattccaggtccgcattaattgcattagatgaaactgaaaagggagtag
gttcaaccgacacccttggcggccaacaggaactagccatcgtcaacgagtccggcatgt
ggacactagtcctacgctgccgtgatgccgtcaagccgggaactgtcccctaccgcgtcc
gcaaatggatcacaggcgaagtccttccctcgatccgcaagacgggcagttataccgcca
cgggaacaatggtgaatgacgatgcactctgcgccatctggtttctgtgcgaccacttca
agaagctgcacgagatgtcccgcgtcaataaggttccgcaagcactgtattggcttggag
cgacagagattagcggtgagcttggtacgcgtctgcttgagggcatgaggggcggcgttc
tcaaaatagaaaaagccctcggcccacacatggaacaggccgcccaaaagggcatgggca
atgcaagcaggcatctgtcatgaacgaacttatacagaaagtaagcgatgcggcgatcac
aagccgtgaaatcgcccagttagtggaatccaggcacgacaacgtgcgtgtaacgattga
aaggttgtccgaacgcggtgtgattgctttacctgcaacgcaggaaaagcccacaggtgg
acgaccgagcatcgaatacgttttcacgggtgaacaaggcaaacgagacagcattgtagt
ggtggcccagctttcacccgagttcacagccagactggtagatcgctggcaagaactgga
aacagagctaatccaaacacgttttgtcattccgcaaacactgccagaagcactccgact
agcggcagacttggctgacaagaaccaggcattagaaaaggtggtggcagatcaatcccc
caaggtgctgacccatgatcggattgcagcagctgatggatcactgtgcctgcgtgacgc
tgccaaggtgttacagatgcgcccgattgacctgcgtcattgg


  Assignments for Essentially Identical Proteins

No essentially identical proteins found

  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value
CDD::33416 963.800;118-294
IPR::IPR003497_interpro_download 51.3;133-223
isoelectric_point 10.28
molecular_weight 35244
PFAM::PF02498_interpro_download 51.3;133-223
PSORT::unknown unknown
similar_to_human no


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search