The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|155920.1.peg.847: Xylella fastidiosa Ann-1

This feature in The SEED Viewer

NCBI Taxonomy Id: 155920

Current Assignment: Phage DNA-binding antirepressor protein Roi
Translate Function Assignments



Context on contig NZ_AAAM01000038 from base 39369 to 50229 (10861 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
844 39369 43934 4566 +       2: 1 2 ff
icw(4)
Type IV fimbrial biogenesis protein PilY1 XfasO0858, ZP_00041054.1, gi|22996810, COG: COG3419
2173 43931 44386 456 + -4     2: 1 2 ff
icw(1)
ilit(
3141743)
ilit(9515697)
Type IV pilus biogenesis protein PilE  
rna.020 44491 44567 77 + 104         tRNA-Asn-GTT tRNA-Asn-GTT
845 45631 44654 978 - 86         Phage integrase XfasO0859, ZP_00041055.1, gi|22996811, COG: COG0582
846 46308 45865 444 - 233     4: 3 4 6 5 ff
idu(6)
idu(6)
idu(6)
ilit(
8063092)
Phage ssDNA binding protein XfasO0860, ZP_00041056.1, gi|22996812, COG: COG0629
847 47079 46366 714 - 57         Phage DNA-binding antirepressor protein Roi XfasO0861, ZP_00041057.1, gi|22996813, COG: COG3646
848 48038 47076 963 - -4         Phage DNA-binding antirepressor protein Roi XfasO0862, ZP_00041058.1, gi|22996814, COG: COG3617
849 49669 48035 1635 - -4         Phage protein XfasO0863, ZP_00041059.1, gi|22996815
850 50229 49666 564 - -4         Phage recombination protein Bet XfasO0864, ZP_00041060.1, gi|22996816

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|155920.1.peg.847 Phage DNA-binding antirepressor protein Roi
MNELIQKVSDAAITSREIAQLVESRHDNVRVTIERLSERGVIALPATQEKPTGGRPSIEY
VFTGEQGKRDSIVVVAQLSPEFTARLVDRWQELETELIQTRFVIPQTLPEALRLAADLAD
KNQALEKVVADQSPKVLTHDRIAAADGSLCLRDAAKVLQMRPIDLRHWLIVNRWIYGRPG
HSGWLAYQHRIQQGVMCHKVTTVQREEGTDKVIEQARITSKGLTTISHELTKAPLVA

MD5 = 71cd81e91c0ae0db7d43ad2d90705efd


  DNA Sequence

>fig|155920.1.peg.847 Phage DNA-binding antirepressor protein Roi
atgaacgaacttatacagaaagtaagcgatgcggcgatcacaagccgtgaaatcgcccag
ttagtggaatccaggcacgacaacgtgcgtgtaacgattgaaaggttgtccgaacgcggt
gtgattgctttacctgcaacgcaggaaaagcccacaggtggacgaccgagcatcgaatac
gttttcacgggtgaacaaggcaaacgagacagcattgtagtggtggcccagctttcaccc
gagttcacagccagactggtagatcgctggcaagaactggaaacagagctaatccaaaca
cgttttgtcattccgcaaacactgccagaagcactccgactagcggcagacttggctgac
aagaaccaggcattagaaaaggtggtggcagatcaatcccccaaggtgctgacccatgat
cggattgcagcagctgatggatcactgtgcctgcgtgacgctgccaaggtgttacagatg
cgcccgattgacctgcgtcattggttaatcgttaaccgctggatctatggcagacccgga
catagtgggtggcttgcctatcaacatcgcatccagcagggcgtgatgtgccacaaagtg
accacagtccaacgtgaagagggcaccgacaaggtgattgagcaagcccgtatcacttca
aagggcctgaccacaatcagtcatgaactcacgaaagcaccattggtcgcgtga


  DNA with Flanking Sequence

>fig|155920.1.peg.847 Phage DNA-binding antirepressor protein Roi
ctgcacatcgttaattccaggtccgcattaattgcattagatgaaactgaaaagggagta
ggttcaaccgacacccttggcggccaacaggaactagccatcgtcaacgagtccggcatg
tggacactagtcctacgctgccgtgatgccgtcaagccgggaactgtcccctaccgcgtc
cgcaaatggatcacaggcgaagtccttccctcgatccgcaagacgggcagttataccgcc
acgggaacaatggtgaatgacgatgcactctgcgccatctggtttctgtgcgaccacttc
aagaagctgcacgagatgtcccgcgtcaataaggttccgcaagcactgtattggcttgga
gcgacagagattagcggtgagcttggtacgcgtctgcttgagggcatgaggggcggcgtt
ctcaaaatagaaaaagccctcggcccacacatggaacaggccgcccaaaagggcatgggc
aatgcaagcaggcatctgtcatgaacgaacttatacagaaagtaagcgatgcggcgatca
caagccgtgaaatcgcccagttagtggaatccaggcacgacaacgtgcgtgtaacgattg
aaaggttgtccgaacgcggtgtgattgctttacctgcaacgcaggaaaagcccacaggtg
gacgaccgagcatcgaatacgttttcacgggtgaacaaggcaaacgagacagcattgtag
tggtggcccagctttcacccgagttcacagccagactggtagatcgctggcaagaactgg
aaacagagctaatccaaacacgttttgtcattccgcaaacactgccagaagcactccgac
tagcggcagacttggctgacaagaaccaggcattagaaaaggtggtggcagatcaatccc
ccaaggtgctgacccatgatcggattgcagcagctgatggatcactgtgcctgcgtgacg
ctgccaaggtgttacagatgcgcccgattgacctgcgtcattggttaatcgttaaccgct
ggatctatggcagacccggacatagtgggtggcttgcctatcaacatcgcatccagcagg
gcgtgatgtgccacaaagtgaccacagtccaacgtgaagagggcaccgacaaggtgattg
agcaagcccgtatcacttcaaagggcctgaccacaatcagtcatgaactcacgaaagcac
cattggtcgcgtgatcatgtcatccgaagcaatgaaacctcccttagcatcactaccacg
gaacactagacatggcacgcggaattaacaaggtgatcctagtcggcaacctggggaacg
agccggatatcaaatacacccaaagcggcatgacgatcaccaacattagcctagcaacca
gcagcaaacgcaaggacagagagggcaatacccaggagcggaccgaatggcaccgcgtca
agtttttcggaaagctgggcgagattgccgccgaatatctgcacaagggatcgcagtgct
acatagagggtgccattcgctacgacaagttcaccggccaggagcgttatgtcactgaga
ttattgctgaccaaatgcacatgcttggcggtcgcggtgaaggctccaaaggaagcccaa
gaaaaacggtattaccgcgtcagcgatcagataaaaacgcttacaaaacctggaaagaag
aggaggttgtcgatgacgagattccgttcttctg


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0003677       F:DNA binding
fig|155920.4.peg.4086 Xylella fastidiosa subsp. sandyi Ann-1 FIG   Phage DNA-binding antirepressor protein Roi
gb|EAO31447.1 Xylella fastidiosa Ann-1     putative DNA-binding protein (Roi)
gi|71729331 Xylella fastidiosa Ann-1 NCBI   putative DNA-binding protein (Roi)
gi|71900919 Xylella fastidiosa Ann-1 NCBI   putative DNA-binding protein (Roi)
img|638358828 Xylella fastidiosa Ann-1 IMG   putative DNA-binding protein (Roi)
ref|ZP_00683034.1 Xylella fastidiosa Ann-1 RefSeq   putative DNA-binding protein (Roi)
tr|Q3R2H2 Xylella fastidiosa Ann-1 TrEMBL   Putative DNA-binding protein (Roi)


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value
IPR::IPR010916_interpro_download 0.0;1-77
isoelectric_point 8.26
molecular_weight 26591
PROSITE::PS00430_interpro_download 0.0;1-77
PSORT::Cytoplasmic 8.96
PSORT_score::Cytoplasmic 8.96
similar_to_human no


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


Tool Description
General Tools
Psi-Blast NCBI's psi-blast is used to locate distant similarities
Transmembrane Predictions
TMpred Tool for Predicting Transmembrane regions
TMHMM Prediction of transmembrane helices in proteins
Protein Signals for Gram negative bacteria
Gram negative PSORT Prediction of protein localization sites
Gram negative SignalP Predicts the presence and location of signal peptide cleavage sites
Protein Signals for Gram positive bacteria
Gram positive PSORT Prediction of protein localization sites
Gram positive SignalP Predicts the presence and location of signal peptide cleavage sites
Other useful tools
LipoP Prediction of lipoproteins and signal peptides in Gram negative bacteria
Radar Rapid Automatic Detection and Alignment of Repeats in protein sequences
PPSearch Search for protein motifs against all patterns stored in the PROSITE pattern database
Gram negative CELLO Subcellular localization predictor at National Chiao Tung University
Gram positive CELLO Subcellular localization predictor at National Chiao Tung University
ProDom A comprehensive set of protein domain families automatically generated from the SWISS-PROT and TrEMBL sequence databases
PDB An Information Portal to Biological Macromolecular Structures
For Specific Organisms
RNAFold The RNAfold web server will predict secondary structures of single stranded RNA or DNA sequences.

< Hide tool descriptions


FIG search