The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|155920.1.peg.846: Xylella fastidiosa Ann-1

This feature in The SEED Viewer

NCBI Taxonomy Id: 155920

Current Assignment: Phage ssDNA binding protein
Translate Function Assignments



Context on contig NZ_AAAM01000038 from base 39369 to 50229 (10861 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
844 39369 43934 4566 +       2: 1 2 ff
icw(4)
Type IV fimbrial biogenesis protein PilY1 XfasO0858, ZP_00041054.1, gi|22996810, COG: COG3419
2173 43931 44386 456 + -4     2: 1 2 ff
icw(1)
ilit(
3141743)
ilit(9515697)
Type IV pilus biogenesis protein PilE  
rna.020 44491 44567 77 + 104         tRNA-Asn-GTT tRNA-Asn-GTT
845 45631 44654 978 - 86         Phage integrase XfasO0859, ZP_00041055.1, gi|22996811, COG: COG0582
846 46308 45865 444 - 233     4: 3 4 6 5 ff
idu(6)
idu(6)
idu(6)
ilit(
8063092)
Phage ssDNA binding protein XfasO0860, ZP_00041056.1, gi|22996812, COG: COG0629
847 47079 46366 714 - 57         Phage DNA-binding antirepressor protein Roi XfasO0861, ZP_00041057.1, gi|22996813, COG: COG3646
848 48038 47076 963 - -4         Phage DNA-binding antirepressor protein Roi XfasO0862, ZP_00041058.1, gi|22996814, COG: COG3617
849 49669 48035 1635 - -4         Phage protein XfasO0863, ZP_00041059.1, gi|22996815
850 50229 49666 564 - -4         Phage recombination protein Bet XfasO0864, ZP_00041060.1, gi|22996816

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
pVir_Plasmid_of_Campylobacter OlgaZ Single-stranded DNA-binding protein
DNA_repair,_bacterial gjo Single-stranded DNA-binding protein
DNA_repair,_bacterial_UmuCD_system gjo *Single-stranded DNA-binding protein
DNA_repair,_bacterial_RecFOR_pathway gjo Single-stranded DNA-binding protein


  Protein Sequence

>fig|155920.1.peg.846 Phage ssDNA binding protein
MARGINKVILVGNLGNEPDIKYTQSGMTITNISLATSSKRKDREGNTQERTEWHRVKFFG
KLGEIAAEYLHKGSQCYIEGAIRYDKFTGQERYVTEIIADQMHMLGGRGEGSKGSPRKTV
LPRQRSDKNAYKTWKEEEVVDDEIPFF

MD5 = 2623ea01c71d238b97a97baa85013810


  DNA Sequence

>fig|155920.1.peg.846 Phage ssDNA binding protein
atggcacgcggaattaacaaggtgatcctagtcggcaacctggggaacgagccggatatc
aaatacacccaaagcggcatgacgatcaccaacattagcctagcaaccagcagcaaacgc
aaggacagagagggcaatacccaggagcggaccgaatggcaccgcgtcaagtttttcgga
aagctgggcgagattgccgccgaatatctgcacaagggatcgcagtgctacatagagggt
gccattcgctacgacaagttcaccggccaggagcgttatgtcactgagattattgctgac
caaatgcacatgcttggcggtcgcggtgaaggctccaaaggaagcccaagaaaaacggta
ttaccgcgtcagcgatcagataaaaacgcttacaaaacctggaaagaagaggaggttgtc
gatgacgagattccgttcttctga


  DNA with Flanking Sequence

>fig|155920.1.peg.846 Phage ssDNA binding protein
aagaactggaaacagagctaatccaaacacgttttgtcattccgcaaacactgccagaag
cactccgactagcggcagacttggctgacaagaaccaggcattagaaaaggtggtggcag
atcaatcccccaaggtgctgacccatgatcggattgcagcagctgatggatcactgtgcc
tgcgtgacgctgccaaggtgttacagatgcgcccgattgacctgcgtcattggttaatcg
ttaaccgctggatctatggcagacccggacatagtgggtggcttgcctatcaacatcgca
tccagcagggcgtgatgtgccacaaagtgaccacagtccaacgtgaagagggcaccgaca
aggtgattgagcaagcccgtatcacttcaaagggcctgaccacaatcagtcatgaactca
cgaaagcaccattggtcgcgtgatcatgtcatccgaagcaatgaaacctcccttagcatc
actaccacggaacactagacatggcacgcggaattaacaaggtgatcctagtcggcaacc
tggggaacgagccggatatcaaatacacccaaagcggcatgacgatcaccaacattagcc
tagcaaccagcagcaaacgcaaggacagagagggcaatacccaggagcggaccgaatggc
accgcgtcaagtttttcggaaagctgggcgagattgccgccgaatatctgcacaagggat
cgcagtgctacatagagggtgccattcgctacgacaagttcaccggccaggagcgttatg
tcactgagattattgctgaccaaatgcacatgcttggcggtcgcggtgaaggctccaaag
gaagcccaagaaaaacggtattaccgcgtcagcgatcagataaaaacgcttacaaaacct
ggaaagaagaggaggttgtcgatgacgagattccgttcttctgaggtggaattcgtgagc
aacctgtggctgagtccagaagaagtgacagaactgaccgcacgcaagaaatgggcagcc
caaacccgagccttgatatcaatgggtatcccgttcaagccgaacgccgttggtcgcccc
ttggtagaacgtgctgctgtgatgtccacgacgccaaccgctagtccacgtcgtaaggca
acgccgaattggaatgcgttgcataaagtagcgtgacatgggcagacgacgaaagcgcaa
caaacaccttcctcaatcaatgttcttccagcatggagcgtactactttgttgctagcgg
caaatggctcccactggggaaagagtacggtgcggcacttggcaaatacgcggtgtttgt
cggaaagaaacctacagtcgatagcgtgaaagacatggtgtggggctacattgaggccaa
gcgtccgaaattgtcagccaaaaccatcgaagggtacgagcgcaatgcagccaacttgtg
cgca


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0003697       F:single-stranded DNA binding
GO:0006260       P:DNA replication
fig|155920.4.peg.4085 Xylella fastidiosa subsp. sandyi Ann-1 FIG   Phage ssDNA binding protein
gb|EAO31446.1 Xylella fastidiosa Ann-1     Single-strand binding protein
gi|71729330 Xylella fastidiosa Ann-1 NCBI   Single-strand binding protein
gi|71900918 Xylella fastidiosa Ann-1 NCBI   Single-strand binding protein
img|638358827 Xylella fastidiosa Ann-1 IMG   Single-strand binding protein
ref|ZP_00683033.1 Xylella fastidiosa Ann-1 RefSeq   Single-strand binding protein
tr|Q3R2H3 Xylella fastidiosa Ann-1 TrEMBL   Single-stranded DNA-binding protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value
CDD::30974 972.200;4-146
CDD::40527 972.700;5-106
evidence_code ff
evidence_code idu(6);DNA_repair,_bacterial
evidence_code idu(6);DNA_repair,_bacterial_RecFOR_pathway
evidence_code idu(6);pVir_Plasmid_of_Campylobacter
evidence_code ilit(8063092);fig|71421.1.peg.235
GO GO:0003697 single-stranded DNA binding
IPR::IPR000424_interpro_download 113.9;5-105
IPR::IPR000424_interpro_download 31.73;5-106
IPR::IPR001547_interpro_download 0.0;10-19
IPR::IPR011010_interpro_download 159.0;1-146
IPR::IPR011344_interpro_download 109.8;5-143
IPR::IPR011344_interpro_download 141.0;3-146
IPR::IPR011344_interpro_download 86.3;39-146
IPR::IPR012340_interpro_download 141.7;1-141
isoelectric_point 9.33
molecular_weight 16776
PANTHER::PTHR10302_interpro_download 141.7;1-141
PANTHER::PTHR10302_interpro_download 86.3;39-146
PFAM::PF00436 969.460;5-105
PFAM::PF00436_interpro_download 113.9;5-105
PROFILE::PS50935_interpro_download 31.73;5-106
PROSITE::PS00659_interpro_download 0.0;10-19
PSORT::unknown unknown
similar_to_human yes
SSF::SSF50249_interpro_download 159.0;1-146
structure Stuctural classification projected from homologous protein in E. coli
TIGRFAMs::TIGR00621_interpro_download 141.0;3-146


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search