The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|155920.1.peg.2173: Xylella fastidiosa Ann-1

This feature in The SEED Viewer

NCBI Taxonomy Id: 155920

Current Assignment: Type IV pilus biogenesis protein PilE
Translate Function Assignments



Context on contig NZ_AAAM01000038 from base 38871 to 49669 (10799 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
843 38871 39365 495 +       2: 1 2 ff
idu(2)
Type IV fimbrial biogenesis protein PilX XfasO0857, ZP_00041053.1, gi|22996809
844 39369 43934 4566 + 3 6 2: 1 2 ff
icw(4)
Type IV fimbrial biogenesis protein PilY1 XfasO0858, ZP_00041054.1, gi|22996810, COG: COG3419
2173 43931 44386 456 + -4   2: 1 2 ff
icw(1)
ilit(
3141743)
ilit(9515697)
Type IV pilus biogenesis protein PilE  
rna.020 44491 44567 77 + 104         tRNA-Asn-GTT tRNA-Asn-GTT
845 45631 44654 978 - 86         Phage integrase XfasO0859, ZP_00041055.1, gi|22996811, COG: COG0582
846 46308 45865 444 - 233     4: 3 4 6 5 ff
idu(6)
idu(6)
idu(6)
ilit(
8063092)
Phage ssDNA binding protein XfasO0860, ZP_00041056.1, gi|22996812, COG: COG0629
847 47079 46366 714 - 57         Phage DNA-binding antirepressor protein Roi XfasO0861, ZP_00041057.1, gi|22996813, COG: COG3646
848 48038 47076 963 - -4         Phage DNA-binding antirepressor protein Roi XfasO0862, ZP_00041058.1, gi|22996814, COG: COG3617
849 49669 48035 1635 - -4         Phage protein XfasO0863, ZP_00041059.1, gi|22996815

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
Type_IV_pilus VeronikaV Type IV pilus biogenesis protein PilE
Bacterial_motility:Gliding OlgaV Type IV pilus biogenesis protein PilE


  Protein Sequence

>fig|155920.1.peg.2173 Type IV pilus biogenesis protein PilE
MMVILKWERVSKRRRIGARQRSYGYHLIELMVVVAVIAILSSIAYPSYQHYILKSHRDQA
KADLVEIAQFAERFRTVNNTYAGFPATNPITQSPRQGTASYLLVFVGDATRTAFTVSAVP
QGTQQNDKCGTLFINQAGIKTNSQGELSECW

MD5 = 0b7534e567fc22567da1c68703c7cbeb


  DNA Sequence

>fig|155920.1.peg.2173 Type IV pilus biogenesis protein PilE
atgatggtgatcctaaagtgggaacgtgtgagcaagcgcaggcggattggggcacggcag
cggtcatacgggtatcacttgattgagttgatggttgtggtcgctgtcattgccatcttg
tcgtccattgcgtatccgtcataccagcattacattctcaagagccatcgggatcaggct
aaggctgatttagtggagattgcccagttcgcggagcgttttcgtacggtgaacaatact
tatgccggattccccgcaaccaatcctataacccagtccccacgccaagggacggcatct
tatcttttggtgtttgttggagatgccacgcgcactgcgtttactgtcagtgcggtgcca
caaggcactcagcaaaacgacaagtgcggtaccttgtttatcaaccaggctggaattaag
acgaatagccaaggtgaattatccgaatgctggtaa


  DNA with Flanking Sequence

>fig|155920.1.peg.2173 Type IV pilus biogenesis protein PilE
ccgctgagttatctcagcaagcatggttggtatgtcgatttggtggtacagggacaggat
ccacagggggagcgttccattgccacaccattgttacaggggggccgtgtcttcttttcg
acctatgtgccgggagtgagtgtgaattgtgcttcgggcgggagcaattggctttatgtg
ttagatgctgcttcaggtggtgccgcgctcggtcaggtcaatataccgtcccgtggctcc
agatccagtatcggtaatagtgatactggtgcggtttcgacgggtggagatgctccaatt
cagagtgttgcaatgacccgcacagcgcctagacaaccggttttttgtaatccaggtgaa
aagggatgtcccttggtgccagagacacatgctgcacctttggatacccgatgcagcgaa
gtcatcattgatccaaatgatccaaccaggtccatctcactgttcagggcatgtggacgg
caatcgtggaggcagttgcgatgatggtgatcctaaagtgggaacgtgtgagcaagcgca
ggcggattggggcacggcagcggtcatacgggtatcacttgattgagttgatggttgtgg
tcgctgtcattgccatcttgtcgtccattgcgtatccgtcataccagcattacattctca
agagccatcgggatcaggctaaggctgatttagtggagattgcccagttcgcggagcgtt
ttcgtacggtgaacaatacttatgccggattccccgcaaccaatcctataacccagtccc
cacgccaagggacggcatcttatcttttggtgtttgttggagatgccacgcgcactgcgt
ttactgtcagtgcggtgccacaaggcactcagcaaaacgacaagtgcggtaccttgttta
tcaaccaggctggaattaagacgaatagccaaggtgaattatccgaatgctggtaacgtg
ttcccgcattgcttttagttggaagcatttcaatgttccagaaaatgcgttgagaataat
gttgattcagtcatgagtggctgggtacaattgcaagattgcccgaatagctcagccggt
tagagcacttgactgttaatcagggggtcgttggttcgagtccaacttcgggcgccataa
tttttttaaatacaagggcttatggaagtataagcccttgttgttttggtcagcagtcta
ataaaggtgggattgtctaataatcacctggttggattgacccgcgtcatcctccgacgg
tagtggcgttgcgtcacttttgcatcagaatgccccaatacctgctgcgcttcttcgacc
gtttcccggtcactccccgccttggctcgtaaatcatgcaggcgcacatctgacagtcct
gccttggccctggcaactcgccacatggcgcgtaggccggacggtgtgtacggtccaatc
ccgcgtttggaatgct


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0008565       F:protein transporter activity
GO:0015627       C:type II protein secretion system complex
GO:0015628       P:protein secretion by the type II secretion ...
cmr|NT02XF2143 Xylella fastidiosa Temecula1     type IV pilin XF0479 [imported]
gb|ACB93106.1 Xylella fastidiosa M23     type IV pilin
gb|EAO31444.1 Xylella fastidiosa Ann-1     type IV pilin
gi|182632330 Xylella fastidiosa M23 NCBI   type IV pilin
gi|182682220 Xylella fastidiosa M23 NCBI   type IV pilin
gi|71729328 Xylella fastidiosa Ann-1 NCBI   type IV pilin
gi|71900916 Xylella fastidiosa Ann-1 NCBI   type IV pilin
img|638358824 Xylella fastidiosa Ann-1 IMG   type IV pilin
img|641703212 Xylella fastidiosa M23 IMG   type IV pilin
kegg|xfn:XfasM23_1702 Xylella fastidiosa M23 KEGG   type IV pilin
ref|YP_001830380.1 Xylella fastidiosa M23 RefSeq   type IV pilin
ref|ZP_00683031.1 Xylella fastidiosa Ann-1 RefSeq   type IV pilin
tr|B2I7U1 Xylella fastidiosa (strain M23) TrEMBL   Type IV pilin
tr|Q3R2H5 Xylella fastidiosa Ann-1 TrEMBL   Type IV pilin


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function
6 fig|155920.1.peg.844 Type IV fimbrial biogenesis protein PilY1


  Attributes

Help on Attributes

Key
Link Explains Key
Value
CDD::34575 960.500;18-151
evidence_code ff
evidence_code icw(1);Type_IV_pilus
evidence_code ilit(3141743);fig|122586.1.peg.18
evidence_code ilit(9515697);fig|122586.1.peg.18
isoelectric_point 10.02
molecular_weight 16945
Phobius::transmembrane 23-45
PSORT::unknown unknown
similar_to_human no


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search