The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|155920.1.peg.1953: Xylella fastidiosa Ann-1

This feature in The SEED Viewer

NCBI Taxonomy Id: 155920

Current Assignment: Phage antirepressor protein
Translate Function Assignments



Context on contig NZ_AAAM01000081 from base 153 to 5938 (5786 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1953 153 746 594 +           Phage antirepressor protein XfasO1990, ZP_00042162.1, gi|22997961, COG: COG3617
1954 882 3428 2547 + 135         Phage primase XfasO1991, ZP_00042163.1, gi|22997962, COG: COG3378
1955 3887 4609 723 + 458         Phage protein XfasO1992, ZP_00042164.1, gi|22997963
1956 4689 5285 597 + 79         Phage lysozyme R (EC 3.2.1.17) XfasO1993, ZP_00042165.1, gi|22997964, COG: COG3772
1957 5278 5607 330 + -8     1: 1   Phage holin XfasO1994, ZP_00042166.1, gi|22997965
1958 5597 5938 342 + -11     1: 1   hypothetical protein XfasO1995, ZP_00042167.1, gi|22997966

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|155920.1.peg.1953 Phage antirepressor protein
MTQLPSAVCFSGKSLSIIDRDGVPHLSARDLAHALGYADERSVLRIYNRHSEEFTYQMTL
VVNLTTVTGDKPTRLFNPRGCHMVSMFARTSVAAAFRRWVLDVLEFMPSIRKTGSYSASH
PPAVTLTEEEAFNLYALLRMVAGHLSRERIEPIEQALHLIRSPLAGAVSDLWREVGPRAK
RMENLAGRCRNAFYRLR

MD5 = 3d324c8073635273876b3c669be50a61


  DNA Sequence

>fig|155920.1.peg.1953 Phage antirepressor protein
atgacgcagttaccctctgccgtgtgtttttccggcaaatccctttccattatcgaccgt
gacggtgttcctcacctaagcgcacgcgatctagcccacgctttgggttacgccgatgaa
cgatccgtattgcgcatctacaaccgtcattccgaagagttcacctatcaaatgaccttg
gtggtcaatttgaccaccgttaccggagacaaacccacccgactcttcaaccctcgtggc
tgccacatggtatcaatgtttgctcgcacttcagttgccgccgcgtttcgtcgctgggtg
ctggatgtgttggaattcatgccctcaatccgcaagacgggcagctactcggcttcgcac
cctcctgctgtcactttgacagaagaagaggcattcaacctgtacgcactgctgaggatg
gtcgcggggcatttgtcacgggaacgcattgagccgattgaacaagccttacatctgatt
cgctcaccgttagccggtgcggtcagcgatttgtggcgggaggtggggccgcgcgctaag
cgcatggagaacctcgctgggcgttgccgcaatgccttctaccgtttgcgctaa


  DNA with Flanking Sequence

>fig|155920.1.peg.1953 Phage antirepressor protein
cgtttttacgtcgggagggcggcagcgatacaacaccctgtaaaggggaaagctgcccgc
cgtctacttccggtttttgacctcccgacacctacgggtgcggcgcgcaaaaacgtctcc
ccgtggtcatcccatgaagtaggagacgttttatgacgcagttaccctctgccgtgtgtt
tttccggcaaatccctttccattatcgaccgtgacggtgttcctcacctaagcgcacgcg
atctagcccacgctttgggttacgccgatgaacgatccgtattgcgcatctacaaccgtc
attccgaagagttcacctatcaaatgaccttggtggtcaatttgaccaccgttaccggag
acaaacccacccgactcttcaaccctcgtggctgccacatggtatcaatgtttgctcgca
cttcagttgccgccgcgtttcgtcgctgggtgctggatgtgttggaattcatgccctcaa
tccgcaagacgggcagctactcggcttcgcaccctcctgctgtcactttgacagaagaag
aggcattcaacctgtacgcactgctgaggatggtcgcggggcatttgtcacgggaacgca
ttgagccgattgaacaagccttacatctgattcgctcaccgttagccggtgcggtcagcg
atttgtggcgggaggtggggccgcgcgctaagcgcatggagaacctcgctgggcgttgcc
gcaatgccttctaccgtttgcgctaaaccatccggctgtctatctggccgtactccttaa
ttattaaggagtgactctcgaatcgttaaaccacccccgcagttaaaaagggcgggctga
gggggtggcctcaactcgcccaaaacaaaggtgaaactcctatgagagattctatcacag
ttctaaaacaccccgtaaataccctcgccaaaacatggcgcgctgatggctcggtgaaag
cctacgacaacgccaagttcttccaggtggagcaacgagcgcttaacaatagtcgcgact
tgtctaacttgctcacggagctggagcagaacccgcatgcctgcgtgattcgcggggcgt
atgtgggtgacgccaaagccgctgcgcttgatactgagttccagaaaggaaaagtacggc
gcattgccgagctgtacgatgatatcccgcatcactggatgcttgttgagatcgacaact
tctacccacggtgccgcgatccggtggccgatccggtggggagtat


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
fig|155920.4.peg.5509 Xylella fastidiosa subsp. sandyi Ann-1 FIG   Phage antirepressor protein
gb|EAO30288.1 Xylella fastidiosa Ann-1     phage-related protein
gi|71728085 Xylella fastidiosa Ann-1 NCBI   phage-related protein
gi|71902151 Xylella fastidiosa Ann-1 NCBI   phage-related protein
img|638359991 Xylella fastidiosa Ann-1 IMG   phage-related protein
ref|ZP_00684175.1 Xylella fastidiosa Ann-1 RefSeq   phage-related protein
tr|Q3QZ82 Xylella fastidiosa Ann-1 TrEMBL   Phage-related protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value
CDD::33416 977.500;1-116
isoelectric_point 9.97
molecular_weight 22246
PSORT::unknown unknown
similar_to_human no


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search