The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|1261557.3.peg.1857: Enterococcus faecalis str. Symbioflor 1

This feature in The SEED Viewer

NCBI Taxonomy Id: 1261557

Current Assignment: Phage antirepressor protein
Translate Function Assignments



Context on contig HF558530 from base 1881147 to 1891973 (10827 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1846 1881374 1881147 228 -           FIG00631220: hypothetical protein locus|EFS1_1846, protein_id|CCO72924.1, gi|427185700
1847 1882026 1881502 525 - 127         hypothetical protein locus|EFS1_1847, protein_id|CCO72925.1, gi|427185701
1848 1882986 1882030 957 - 3         Phage replication initiation locus|EFS1_1848, protein_id|CCO72926.1, gi|427185702
1849 1883671 1882991 681 - 4         conserved hypothetical protein locus|EFS1_1849, protein_id|CCO72927.1, gi|427185703
1850 1884591 1883668 924 - -4         FIG00631158: hypothetical protein locus|EFS1_1850, protein_id|CCO72928.1, gi|427185704
1851 1885268 1884591 678 - -1         putative recombination protein / Single-stranded DNA-binding protein locus|EFS1_1851, protein_id|CCO72929.1, gi|427185705
1852 1885505 1885269 237 - 0         FIG00630937: hypothetical protein locus|EFS1_1852, protein_id|CCO72930.1, gi|427185706
1853 1885717 1885562 156 - 56         FIG00629633: hypothetical protein locus|EFS1_1853, protein_id|CCO72931.1, gi|427185707
1854 1885827 1885702 126 - -16         conserved hypothetical protein locus|EFS1_1854, protein_id|CCO72932.1, gi|427185708
1855 1885997 1885824 174 - -4         FIG00627754: hypothetical protein locus|EFS1_1855, protein_id|CCO72933.1, gi|427185709
1856 1886267 1886019 249 - 21         hypothetical protein locus|EFS1_1856, protein_id|CCO72934.1, gi|427185710
1857 1887002 1886283 720 - 15         Phage antirepressor protein locus|EFS1_1857, protein_id|CCO72935.1, gi|427185711
1858 1887317 1887084 234 - 81         hypothetical protein within a prophage locus|EFS1_1858, protein_id|CCO72936.1, gi|427185712
1859 1887476 1888048 573 + 158         Phage repressor locus|EFS1_1859, protein_id|CCO72937.1, gi|427185713
1860 1888065 1888538 474 + 16         FIG00631970: hypothetical protein locus|EFS1_1860, protein_id|CCO72938.1, gi|427185714
1861 1888626 1889180 555 + 87         hypothetical protein locus|EFS1_1861, protein_id|CCO72939.1, gi|427185715
1862 1889222 1889422 201 + 41         FIG00631593: hypothetical protein locus|EFS1_1862, protein_id|CCO72940.1, gi|427185716
1863 1889483 1890055 573 + 60         hypothetical protein locus|EFS1_1863, protein_id|CCO72941.1, gi|427185717
1864 1890122 1891258 1137 + 66         Phage integrase locus|EFS1_1864, protein_id|CCO72942.1, gi|427185718
1865 1891973 1891452 522 - 193         tRNA-specific adenosine-34 deaminase (EC 3.5.4.-) locus|EFS1_1865, protein_id|CCO72943.1, gi|427185719

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|1261557.3.peg.1857 Phage antirepressor protein
MNELIKVTTNENDEQLVNGRELYEFLGVKDNYTDWFKRMIKYGFDENVDFISFSEKSDKP
FGGRPQVNHYVKLDMAKEISMLQRTERGKQARRYFIQLEKFWNSPEMLTKRALEFQQKKI
EVLQLENESLKPKALFADAVDASKTSILIGDLAKLIKQNGIDIGQNRLFQWLRDNGYLIA
RKGESYNMPTQRSLDLGIAEIKERTHNNPDGSIRISRTPKITGKGQIYFVNKFLHDKTA

MD5 = f82a2e56afbec71cbb502b68a99cfab3


  DNA Sequence

>fig|1261557.3.peg.1857 Phage antirepressor protein
atgaacgaactaattaaagttacaacaaatgaaaatgatgaacagttagttaacggtaga
gagttatatgaatttctgggagttaaagataattatactgattggtttaaacgaatgatt
aaatacgggtttgatgaaaacgttgattttatcagtttctcggaaaaatccgataaacct
tttggtggtcgcccacaagtaaatcattatgtgaaactagacatggctaaggaaatttca
atgctacaacgtaccgaaagaggaaagcaagctcgtagatattttattcaactagaaaag
ttttggaatagcccagaaatgctgactaaacgagctcttgaatttcaacagaaaaaaata
gaagtattacaactagaaaatgaatcattaaaacctaaagcattatttgcagatgccgtt
gatgcaagtaagacttccattttaatcggtgacctagctaagctaatcaagcaaaacggc
atcgacattgggcagaatcgtttattccaatggctgcgagacaatgggtatctaattgct
cgaaaaggtgaaagctacaatatgccaacccagcggtcacttgatttgggaattgcggaa
atcaaggaacgaacccataacaatccagatggaagtattcgaattagtcgaacgccgaaa
attactggtaaagggcaaatatattttgttaacaagttcttacatgacaagacagcatag


  DNA with Flanking Sequence

>fig|1261557.3.peg.1857 Phage antirepressor protein
acgagcagatgttttaactctatccattggtacacctccttatagatttaagtatacaag
atattgaatatatcttcaacgaaaaaattcatgaatcatgaactttttcgttgacaataa
gaaatgaacaatgtattatatggttataaagttcatgttcatgaacttgaaggaggtgtt
tataaatgtgctatgattactcaaaattagcaggaagaattgttgaaaagtttggaactc
aatataattttgctatcgcaatgggattgtcggagagaacaatatcattgaaaatgaacg
ggaaagtctcttggaaagacactgaaattacgaaagcttgcaaattgctagacttggaaa
caaattttattcatttatatttttttaaagagaaagttcatgtttgtgaacaaaggtagt
tttggaagtatacaaatgaaaaaggaaaagtgttccattaatggaacgaaagacaaccag
aatagaagggatgaaaccgtatgaacgaactaattaaagttacaacaaatgaaaatgatg
aacagttagttaacggtagagagttatatgaatttctgggagttaaagataattatactg
attggtttaaacgaatgattaaatacgggtttgatgaaaacgttgattttatcagtttct
cggaaaaatccgataaaccttttggtggtcgcccacaagtaaatcattatgtgaaactag
acatggctaaggaaatttcaatgctacaacgtaccgaaagaggaaagcaagctcgtagat
attttattcaactagaaaagttttggaatagcccagaaatgctgactaaacgagctcttg
aatttcaacagaaaaaaatagaagtattacaactagaaaatgaatcattaaaacctaaag
cattatttgcagatgccgttgatgcaagtaagacttccattttaatcggtgacctagcta
agctaatcaagcaaaacggcatcgacattgggcagaatcgtttattccaatggctgcgag
acaatgggtatctaattgctcgaaaaggtgaaagctacaatatgccaacccagcggtcac
ttgatttgggaattgcggaaatcaaggaacgaacccataacaatccagatggaagtattc
gaattagtcgaacgccgaaaattactggtaaagggcaaatatattttgttaacaagttct
tacatgacaagacagcatagaaaggagatgtctacatgcaaatcacactagcaaagacta
tcgatttacagcaagcttggatggcaaaagatgaagcaattgtttattttggctatcagc
atcacaaaccaacatttcaaaaacttctgagagagtttaaggaacataaagaatttaaag
atggatatagactcgttacatcatgcatgccaattatccacattcagaaatttgatgaat
ttttggtttggcgggaaaaaaacaagtataagcgaaataaatagacgttataggaggtaa
ataatatgagaaaaatttataacttaagaagaattgcagtactgcttattgttttcggat
tgggtctgctagtgggtggaaactttaatccaatcatccaaaatgtgtatattggattgt
tcattatttggacattattttatgacttagctcttgaagatagagaggtaaataaatgac
aaggaaagaaaaactacagcaaacgaaaaaacttgctgat


  Assignments for Essentially Identical Proteins

No essentially identical proteins found

  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search