The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|1165952.3.peg.809: Escherichia coli O26:H11 str. CVM10030

This feature in The SEED Viewer

NCBI Taxonomy Id: 1165952

Current Assignment: hypothetical protein
Turn Off Function Translation



Context on contig AKBA01000028 from base 115 to 4176 (4062 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
806 804 115 690 -           Phage antitermination protein Q locus|ECO10030_12359, protein_id|EJF04004.1, gi|394431855
807 1280 2239 960 + 475         Outer membrane protein locus|ECO10030_12364, protein_id|EJF04005.1, gi|394431856
808 2998 2636 363 - 396         Holliday junction resolvase / Crossover junction endodeoxyribonuclease rusA (EC 3.1.22.-) locus|ECO10030_12374, protein_id|EJF04007.1, gi|394431858
809 3285 2995 291 - -4         hypothetical protein locus|ECO10030_12379, protein_id|EJF04008.1, gi|394431859
810 4007 3285 723 - -1         Phage DNA binding protein Roi locus|ECO10030_12384, protein_id|EJF04009.1, gi|394431860
811 4176 4000 177 - -8         Phage NinF locus|ECO10030_12389, protein_id|EJF04010.1, gi|394431861

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|1165952.3.peg.809 hypothetical protein
MANLRKESRGRECQVRIYGICNGNPETTVLAHYRMAGICGTGMKPDDLIGAWACSACHDE
IDRRTHNLDNKDARLYHLEGVIRTQAILLKEGKIKS

MD5 = 1ca9796b77e541158f8579c6bdf48c2b


  DNA Sequence

>fig|1165952.3.peg.809 hypothetical protein
atggctaacctacgcaaagaatctcgcggcagagaatgccaggtacgtatttacggcata
tgcaatggcaatcctgaaactacagttctggcacattaccggatggctggaatttgcgga
acgggaatgaagcctgacgacctgatcggcgcatgggcttgtagcgcgtgtcacgatgaa
atcgaccgacgcacccataacctcgacaacaaagacgccagactttaccacctcgaaggc
gtgatcaggacgcaggcgatactgctgaaggaggggaagattaagtcatga


  DNA with Flanking Sequence

>fig|1165952.3.peg.809 hypothetical protein
agtattgtcgttgttgcccagttgtcgccagagttcaccgctcgtcttgttgaccgttgg
cgagagcttgaagaaactgcggttaatatccccaaaacgttaccggaagcgttgcgcctt
gctgctgatcttgctgagcagaaaatgcaactggaaaaccagctcgcaattgccgcacct
aaagttgagtttgccgatcgcgttggcgaggccagcggaattttgattggaaactttgca
aaggttgttggtattggtccaaacaaactgtttgcgtggatgcgcgatcacaaaatcctt
attgcttcaggttcccggcgcaatgtgccaatgcaggaatatatggatcgcggctatttc
acagtgaaagaaacagcggtcaacacaaatcacggaatacagatatcgttcaccacaaaa
atcaccgggcgtggtcaacagtggctgaccagaaagctgctcgataacggaatgctgaaa
gtaacaggggaggctgcttaatggctaacctacgcaaagaatctcgcggcagagaatgcc
aggtacgtatttacggcatatgcaatggcaatcctgaaactacagttctggcacattacc
ggatggctggaatttgcggaacgggaatgaagcctgacgacctgatcggcgcatgggctt
gtagcgcgtgtcacgatgaaatcgaccgacgcacccataacctcgacaacaaagacgcca
gactttaccacctcgaaggcgtgatcaggacgcaggcgatactgctgaaggaggggaaga
ttaagtcatgaacgaatatcagtttgtgcttccatacccgccgtcggtgaatacctactg
gcgaagacggggaagccaatactacatcagcgataaaggccagaaataccgaaaagacgt
tcagcaaatcatccaccaactcaagttagatattttcaccaaatcacgactccgcatcaa
agtaatcgcagacgttccagactcccgccgccgcgacctagataacatcctgaagggttt
actcgactcccttatccatgccggatttgcggaagacgacgagcaattcgatgacattcg
cgtaattcgtggtgtgaaagtaccaggcggacggcttggaataaaaatcaccgaactgga
gaacgcatgaacgccacaattcaaacgataccagagcttcttatccagacacgaggcaat
cagaccgaagtggcgaggatgctttcctgcgcaagaggaacagtgctcaagtacaaccga
gacagcaaaggcgagcgtcatgtaatagtta


  Assignments for Essentially Identical Proteins

No essentially identical proteins found

  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search