The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|1158682.3.peg.1013: Staphylococcus aureus M0528

This feature in The SEED Viewer

NCBI Taxonomy Id: 1158682

Current Assignment: Phage antirepressor protein
Translate Function Assignments



Context on contig AIXB01000012 from base 343863 to 351436 (7574 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1005 345002 343863 1140 -           tRNA(Met) N4-acetylcytidine(34) synthetase locus|U1M_01016, protein_id|ENK50101.1, gi|477835699
1006 345129 345686 558 + 126         LSU rRNA accumulation protein YceD locus|U1M_01017, protein_id|ENK50102.1, gi|477835700
1007 345766 345939 174 + 79     1: 1   LSU ribosomal protein L32p locus|U1M_01018, protein_id|ENK50103.1, gi|477835701
1008 347441 346056 1386 - 116         Phage DNA recombinase locus|U1M_01019, protein_id|ENK50104.1, gi|477835702
1009 347550 347729 180 + 108         Phage excisionase locus|U1M_01020, protein_id|ENK50105.1, gi|477835703
1010 348641 347709 933 - -21         Hypothetical protein, SAV0849 homolog [SA bacteriophages 11, Mu50B] locus|U1M_01021, protein_id|ENK50106.1, gi|477835704
1011 349393 348677 717 - 35         Phage repressor locus|U1M_01022, protein_id|ENK50107.1, gi|477835705
1012 349557 349799 243 + 163         Phage transcriptional regulator cro locus|U1M_01023, protein_id|ENK50108.1, gi|477835706
1013 349815 350603 789 + 15         Phage antirepressor protein locus|U1M_01024, protein_id|ENK50109.1, gi|477835707
1014 350699 350815 117 + 95         ORF077  
1015 350868 351044 177 + 52         Phage phi 11 orf9 protein homolog locus|U1M_01025, protein_id|ENK50110.1, gi|477835708
1016 351249 351019 231 - -26         Phage protein locus|U1M_01026, protein_id|ENK50111.1, gi|477835709
1017 351299 351436 138 + 49         hypothetical protein locus|U1M_01027, protein_id|ENK50112.1, gi|477835710

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|1158682.3.peg.1013 Phage antirepressor protein
MQALQTFNFEELPVNTLTIENEPYVVGNEVAKILGYSNYRNAINNHVEDEDKLRTQIRYA
GQLRTVTLINESGLYSLIFDASKQSKNEKIRETARKFKRWVTSDVLPAIRKHGIYATDNV
IEQTLKDPDYIITVLTEYKKEKEQNLLLQQEIGELKPKADYVDEILKSTGTLATTQIAAD
YGISAQKLNKLLHEARLQRKVNKQWVLYSEHMGKSYTESDTIPIVRSDGREDTVLQTRWT
QKGRLKIHEIMTEFGYEANVTA

MD5 = 4719aa84660f8d3741fe43358fd3e46e


  DNA Sequence

>fig|1158682.3.peg.1013 Phage antirepressor protein
atgcaagcattacaaacatttaattttgaagaattaccagtaaatacattaacaatcgaa
aatgaaccatacgttgtaggtaacgaagtagctaagatattaggatattcaaattatcga
aacgctataaataaccatgtagaggatgaggataagctacgtacccaaattaggtacgca
ggtcaattaaggactgtgacattaatcaacgaatcaggattatacagtctaatcttcgat
gcttctaaacaaagcaaaaacgaaaaaatcagagaaaccgctcggaaattcaaacgatgg
gtaacatcagatgtcctaccagctattcgcaaacacggtatatacgcaacagacaatgta
attgaacaaacattaaaagatccagactacatcattacagtgttgactgagtataagaaa
gaaaaagagcaaaacttacttttacaacaagaaattggagagctaaaacccaaagcagac
tatgtagatgaaatcttaaagtcaactggaacattagctacaactcaaatcgcggcagac
tacggtatatcagcacaaaagttaaacaaactactacacgaagctagattacaacgaaaa
gtgaataaacagtgggtgctttactcagaacacatgggcaagagttacacagaatcagac
actataccaattgtacgctctgacggtagagaagacacagttttacaaactagatggaca
caaaaaggtagattgaaaatacatgaaatcatgactgaattcggttatgaagctaacgta
actgcttaa


  DNA with Flanking Sequence

>fig|1158682.3.peg.1013 Phage antirepressor protein
cagtccttcttgatagctctgattgagatatcttccgttcagacataatttgctttaatc
tatccttaaaactgttcatatttctgaacacctcctaagaatataatactacgtacaatg
acgattatcaataatttttaacaaatgttgtacagaaaaatgtattttatgtgttgactt
atttaaacaaaggtgttttaattgatttgtacagaaaaccgaacaagaagggaggtgagt
ttatgatatacaatttcgattatagtttgctgtacgaaagaatggcagagtatagatata
gccaaagttctttagcgaacgcaatccctatttcaaggacatctattaatcacaagttgc
aaggaaaaaatttattcacacaatgggaaataaaacgaatctgtgaattattagaaatcc
cgccaacaaaagtaggtagatatttttttgaacaaaatgtacagaaaactgtacaaacat
cttaaaaggaggaacgaacaatgcaagcattacaaacatttaattttgaagaattaccag
taaatacattaacaatcgaaaatgaaccatacgttgtaggtaacgaagtagctaagatat
taggatattcaaattatcgaaacgctataaataaccatgtagaggatgaggataagctac
gtacccaaattaggtacgcaggtcaattaaggactgtgacattaatcaacgaatcaggat
tatacagtctaatcttcgatgcttctaaacaaagcaaaaacgaaaaaatcagagaaaccg
ctcggaaattcaaacgatgggtaacatcagatgtcctaccagctattcgcaaacacggta
tatacgcaacagacaatgtaattgaacaaacattaaaagatccagactacatcattacag
tgttgactgagtataagaaagaaaaagagcaaaacttacttttacaacaagaaattggag
agctaaaacccaaagcagactatgtagatgaaatcttaaagtcaactggaacattagcta
caactcaaatcgcggcagactacggtatatcagcacaaaagttaaacaaactactacacg
aagctagattacaacgaaaagtgaataaacagtgggtgctttactcagaacacatgggca
agagttacacagaatcagacactataccaattgtacgctctgacggtagagaagacacag
ttttacaaactagatggacacaaaaaggtagattgaaaatacatgaaatcatgactgaat
tcggttatgaagctaacgtaactgcttaacaggagggcgcagcaaatggaagatcaaaac
aaaaaaagtcatttattactactatgacgaagcaggtaatagacaactattatcaattgg
agatttgaatctctatttattaaaagatattaaatcaagatttggtttatataaaaaaca
aatccctgatttagataatctgttcgttcaaatagacggtgttgaatttaaagtactata
acccgagcaatgcacctcttaaacaacattatacacgaaaggagcataaacaaatgaaca
cactatacaaaacaaccttcctcatcacaatggcagttgcgacttggaaggtttggaaga
ttgagaaaaacacaagatttaaacttagaaattttgattatccaaaaattaataatgctc
agagcaaatcattgttggatattgctagtcacgatttaaaagatatttaactgtattcaa
aattttcatatcttgttgagcttttaagctttcgtataaagctattgaa


  Assignments for Essentially Identical Proteins

No essentially identical proteins found

  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search