The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|1157453.3.peg.2310: Enterococcus faecium UAA714

This feature in The SEED Viewer

NCBI Taxonomy Id: 1157453

Current Assignment: Phage antirepressor protein
Translate Function Assignments



Context on contig AIUF01000037 from base 26616 to 37846 (11231 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
2299 26975 26616 360 -           ORF033 locus|SIW_02266, protein_id|EOL04586.1, gi|487185911
2300 27823 26972 852 - -4         Helicase loader DnaI locus|SIW_02267, protein_id|EOL04587.1, gi|487185912
2301 28670 27840 831 - 16         Phage replication initiation locus|SIW_02268, protein_id|EOL04588.1, gi|487185913
2302 29359 28673 687 - 2         Phage protein locus|SIW_02269, protein_id|EOL04589.1, gi|487185914
2303 30099 29365 735 - 5         Phage protein locus|SIW_02270, protein_id|EOL04590.1, gi|487185915
2304 30433 30092 342 - -8         FIG00627384: hypothetical protein locus|SIW_02271, protein_id|EOL04591.1, gi|487185916
2305 30617 30489 129 - 55         FIG00631505: hypothetical protein locus|SIW_02272, protein_id|EOL04592.1, gi|487185917
2306 30944 30756 189 - 138         FIG00633031: hypothetical protein locus|SIW_02274, protein_id|EOL04594.1, gi|487185919
2307 31249 30965 285 - 20         FIG00630724: hypothetical protein locus|SIW_02275, protein_id|EOL04595.1, gi|487185920
2308 31596 31297 300 - 47         FIG00629011: hypothetical protein locus|SIW_02276, protein_id|EOL04596.1, gi|487185921
2309 31814 31611 204 - 14         hypothetical protein locus|SIW_02277, protein_id|EOL04597.1, gi|487185922
2310 32575 31829 747 - 14         Phage antirepressor protein locus|SIW_02278, protein_id|EOL04598.1, gi|487185923
2311 32651 32902 252 + 75         hypothetical protein locus|SIW_02279, protein_id|EOL04599.1, gi|487185924
2312 33038 32883 156 - -20         hypothetical protein locus|SIW_02280, protein_id|EOL04600.1, gi|487185925
2313 33432 33274 159 - 235         hypothetical protein locus|SIW_02281, protein_id|EOL04601.1, gi|487185926
2314 33733 34053 321 + 300         Helix-turn-helix motif locus|SIW_02282, protein_id|EOL04602.1, gi|487185927
2315 34071 34493 423 + 17         Protein of unknown function DUF955 locus|SIW_02283, protein_id|EOL04603.1, gi|487185928
2316 34760 34885 126 + 266         hypothetical protein locus|SIW_02284, protein_id|EOL04604.1, gi|487185929
2317 34993 36132 1140 + 107         Phage integrase locus|SIW_02285, protein_id|EOL04605.1, gi|487185930
2318 37846 36221 1626 - 88         Heat shock protein 60 family chaperone GroEL locus|SIW_02286, protein_id|EOL04606.1, gi|487185931

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|1157453.3.peg.2310 Phage antirepressor protein
MNTPQIFNFEQNEVRTFLENDIPYFVANDVAKTLGYKNPSDATNKHCKKAVKTWGSDSLG
RRQSFKVIPESDVYRLIIKSNLPSAEKFEAWVMEEVLPTIRKTGSYSNVPQSFAQALRLA
ADLEEKNQLLEQQIAEYEPKISYLDTILSSTDTVATSQIAADYGMSAIALNKLLNELGVQ
HKVSGQWILYRKHMNQGYTKSHTSEIPKADGGTKVVMNTKWTQKGRVFIYNLLIAEGYYP
QMDLEEIC

MD5 = 5d8c7cea42cb9beff52b2cb817d01756


  DNA Sequence

>fig|1157453.3.peg.2310 Phage antirepressor protein
atgaacacaccacaaattttcaatttcgaacaaaacgaagttcggacgtttctagaaaat
gacattccgtatttcgtagcaaatgatgtcgctaaaacattaggatacaaaaacccgagc
gatgctactaataaacattgtaaaaaagccgtaaaaacatggggtagcgattcgctaggt
cgtcgccaatctttcaaagttattccagaatcagatgtttaccgcttgattatcaaatcg
aacttaccaagcgctgaaaaatttgaggcttgggtaatggaagaagtccttccaacaatc
agaaaaacaggtagctattcaaatgtacctcaaagttttgcacaagcattgcgtttagca
gcagatttagaagaaaagaaccaattactcgaacaacaaattgccgagtacgaaccaaag
attagctacttagatacgattctttcatcgacagatacggtagcgacttctcaaattgca
gctgattacggaatgtcggcaattgctctaaacaaattgcttaacgagttaggtgttcaa
cataaagttagcggacaatggatactttaccgaaaacatatgaaccaaggatacacaaaa
tcgcacacaagtgagattccgaaagccgatggcggcactaaagttgtaatgaataccaaa
tggacacagaaagggcgagtgtttatttacaacttattaatcgcagagggctattaccct
caaatggatttagaggaaatttgttag


  DNA with Flanking Sequence

>fig|1157453.3.peg.2310 Phage antirepressor protein
tttctacagtgagtataccagagaaggaggtaacaacatgaaaattagcattgaagcaaa
gccacaagaaatagcagaattgctccaagctattggaagtagcaaggagcacactaaacg
caaacatccagaatcgaaaatagaatatgatccgcagacgggtgaaggaaagcttattcc
tcaaaataaataataaccttcttgcttcgtaccggtattgtctgattgaatttacggttc
gaatagatagttaaaaactcactatcacgagcaacgcatattacagtatcatcttcgaat
tcttgaagaatcatatcgtggttgaaagtaaataatgtacgagttttatctggcgcctca
attttgaattcatttacgaactctatgggcaattcagactggaaatccaatttatagtct
ttcaaagttgccacctccttatcaattatttcagcctgtcacactgataaggaaattata
ccaaagaaaggaatgaaaaaatgaacacaccacaaattttcaatttcgaacaaaacgaag
ttcggacgtttctagaaaatgacattccgtatttcgtagcaaatgatgtcgctaaaacat
taggatacaaaaacccgagcgatgctactaataaacattgtaaaaaagccgtaaaaacat
ggggtagcgattcgctaggtcgtcgccaatctttcaaagttattccagaatcagatgttt
accgcttgattatcaaatcgaacttaccaagcgctgaaaaatttgaggcttgggtaatgg
aagaagtccttccaacaatcagaaaaacaggtagctattcaaatgtacctcaaagttttg
cacaagcattgcgtttagcagcagatttagaagaaaagaaccaattactcgaacaacaaa
ttgccgagtacgaaccaaagattagctacttagatacgattctttcatcgacagatacgg
tagcgacttctcaaattgcagctgattacggaatgtcggcaattgctctaaacaaattgc
ttaacgagttaggtgttcaacataaagttagcggacaatggatactttaccgaaaacata
tgaaccaaggatacacaaaatcgcacacaagtgagattccgaaagccgatggcggcacta
aagttgtaatgaataccaaatggacacagaaagggcgagtgtttatttacaacttattaa
tcgcagagggctattaccctcaaatggatttagaggaaatttgttagaaaggagttttag
tatgactgacattgcagaaatcactcaacgagatagagaaaaaatcaaagaatatgtcga
aagttcgaagttcttaacttacaccatgcttgctgaaagatttggaattagtaaaagcta
tttatctttaattttaaacggtaaaaagacttctgcagaagcaaacagaattatagattc
gattatcactatgtacgaattgtagaggaggaaaacgaaatgaaaaaaccaacgctttcg
gagttgatagaagctactgagaaggcagcaaacccagacgattggtatcgtcaaagtttg
atcttggagaagttccacggcatgtcaaaaactactttagttgaatactgcaaggaaatg
gaaacaattcctgaattttcagaaggaattgttcgtccaggacattcaaccacatttatt
cattaccatacttttatttggtttttaaaatggaaagacgcaaataaatatcgtgtaaaa
atattgt


  Assignments for Essentially Identical Proteins

No essentially identical proteins found

  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search