The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|1155766.14.peg.2499: Enterococcus faecium Aus0004

This feature in The SEED Viewer

NCBI Taxonomy Id: 1155766

Current Assignment: hypothetical protein
Translate Function Assignments



Context on contig NC_017022 from base 2426050 to 2436567 (10518 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
2486 2426799 2426050 750 -           Phage replication initiation locus|EFAU004_02399, protein_id|YP_005355600.1, gi|383329716, geneID|11955785
2487 2427488 2426802 687 - 2         Phage protein locus|EFAU004_02400, protein_id|YP_005355601.1, gi|383329717, geneID|11955786
2488 2427970 2427494 477 - 5         Phage protein locus|EFAU004_02401, protein_id|YP_005355602.1, gi|383329718, geneID|11955787
2489 2428300 2428434 135 + 329         hypothetical protein  
2490 2428607 2428431 177 - -4         hypothetical protein locus|EFAU004_02402, protein_id|YP_005355603.1, gi|383329719, geneID|11955788
2491 2428729 2428604 126 - -4         FIG00631505: hypothetical protein locus|EFAU004_02403, protein_id|YP_005355604.1, gi|383329720, geneID|11955789
2492 2428871 2428698 174 - -32         hypothetical protein locus|EFAU004_02404, protein_id|YP_005355605.1, gi|383329721, geneID|11955790
2493 2429056 2428868 189 - -4         FIG00629649: hypothetical protein locus|EFAU004_02405, protein_id|YP_005355606.1, gi|383329722, geneID|11955791
2494 2429361 2429077 285 - 20         FIG00630724: hypothetical protein locus|EFAU004_02406, protein_id|YP_005355607.1, gi|383329723, geneID|11955792
2495 2429708 2429409 300 - 47         FIG00629011: hypothetical protein locus|EFAU004_02407, protein_id|YP_005355608.1, gi|383329724, geneID|11955793
2496 2430016 2429813 204 - 104         Helix-turn-helix domain protein locus|EFAU004_02408, protein_id|YP_005355609.1, gi|383329725, geneID|11955794
2497 2430777 2430031 747 - 14         Phage antirepressor protein locus|EFAU004_02409, protein_id|YP_005355610.1, gi|383329726, geneID|11955795
2498 2430855 2431163 309 + 77         hypothetical protein locus|EFAU004_02410, protein_id|YP_005355611.1, gi|383329727, geneID|11955796
2499 2431391 2431134 258 - -30         hypothetical protein locus|EFAU004_02411, protein_id|YP_005355612.1, gi|383329728, geneID|11955797
2500 2431829 2431689 141 - 297         hypothetical protein locus|EFAU004_02412, protein_id|YP_005355613.1, gi|383329729, geneID|11955798
2501 2432123 2432443 321 + 293         Helix-turn-helix motif locus|EFAU004_02413, protein_id|YP_005355614.1, gi|383329730, geneID|11955799
2502 2432461 2432892 432 + 17         Protein of unknown function DUF955 locus|EFAU004_02414, protein_id|YP_005355615.1, gi|383329731, geneID|11955800
2503 2433019 2433603 585 + 126         hypothetical protein locus|EFAU004_02415, protein_id|YP_005355616.1, gi|383329732, geneID|11955801
2504 2433714 2434853 1140 + 110         Phage integrase gene_name|xerC, locus|EFAU004_02416, protein_id|YP_005355617.1, gi|383329733, geneID|11955802
2505 2436567 2434942 1626 - 88     1: 1   Heat shock protein 60 family chaperone GroEL gene_name|groL, locus|EFAU004_02417, protein_id|YP_005355618.1, gi|383329734, geneID|11955803

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|1155766.14.peg.2499 hypothetical protein
MNKEMSQTIKVQKMIDDLTHGIDSQADKIIKELQGQKVKDAKMLLKTINFEMNPTKRKLA
DVLEEKLASAINEQELLFETDTFNS

MD5 = 63a7a2cc09b01eff1c29f9293ae51e3e


  DNA Sequence

>fig|1155766.14.peg.2499 hypothetical protein
atgaacaaggaaatgagccaaacaatcaaggtacaaaaaatgatagatgatctaacacat
ggaattgatagccaagccgataaaatcatcaaggaattgcaaggacaaaaagttaaggat
gcaaaaatgcttctcaagactatcaactttgaaatgaatccaacaaaaagaaagctcgcc
gatgtgttggaagaaaagttggcttccgctatcaacgagcaagaattactatttgaaacc
gatacttttaacagctga


  DNA with Flanking Sequence

>fig|1155766.14.peg.2499 hypothetical protein
aacgcagttttttaaaaagttgttaaatttgtttacgaatataaaagaaaggagagaaga
atatggaaaaaacagtctcggcaaaaatcgaagatttgaaattagacatactgaaacaag
caaaagtggcgatggaacacgcggtagataaagaagactctgccatggttgcagccatag
cagagattttagctcacgtttagtcatcgtttttacggtcttctggaagctgaccataga
taacagcataatgaatatctaaataagcttgaacaatttcttttggcgaaattgattcgc
ctttagtagatacttgtgattcgtgatttagccatgcaacaactaaatccgcagcgattt
caaacggcgttacactttgtgtcagttgccataaagaatttcacaatatgtatggtcgtg
gtaataataccaaagagcaatttgaggaatttatggaaattaaaaaatacaaaaaatcat
ttattaaaggaggctaaacaatgaacaaggaaatgagccaaacaatcaaggtacaaaaaa
tgatagatgatctaacacatggaattgatagccaagccgataaaatcatcaaggaattgc
aaggacaaaaagttaaggatgcaaaaatgcttctcaagactatcaactttgaaatgaatc
caacaaaaagaaagctcgccgatgtgttggaagaaaagttggcttccgctatcaacgagc
aagaattactatttgaaaccgatacttttaacagctgatgttttatagatgacagtttca
tccgaatctatatcatcgccgagagaaaagaatgttgcttttgacaaaaagccgataaga
cctacaagcggtcttgatgttgcaagagtagataccccaatatcaccttgcaaggtattc
acgtaaatttgagaagaatagaacattccatctttttcttcgatatttgacgcatcatcg
tatccaacgaccaaagtatcggcaaatattttgattttttctccatcaagcatagtaatt
acaaattctggtttcataaattttcacctccttaacaattatttcagcctgtcacactga
taaggaaattataccaaagaaaggaatgagaaatatgaatacaccacaaatttttaattt
cgagcaaaacgaagttcgaactattttagtaaatgatgaaccatattttgtaggaaaaga
tgtagcagacgttctaggatattcgaatccgcaaaaagctattcgagatcatgtggac


  Assignments for Essentially Identical Proteins

No essentially identical proteins found

  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search