The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|1155766.14.peg.2497: Enterococcus faecium Aus0004

This feature in The SEED Viewer

NCBI Taxonomy Id: 1155766

Current Assignment: Phage antirepressor protein
Turn Off Function Translation



Context on contig NC_017022 from base 2424991 to 2436567 (11577 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
2483 2425308 2424991 318 -           Phage protein locus|EFAU004_02396, protein_id|YP_005355597.1, gi|383329713, geneID|11955782
2484 2425607 2425308 300 - -1         FIG00631516: hypothetical protein locus|EFAU004_02397, protein_id|YP_005355598.1, gi|383329714, geneID|11955783
2485 2425764 2425600 165 - -8         FIG00632008: hypothetical protein  
2486 2426799 2426050 750 - 285         Phage replication initiation locus|EFAU004_02399, protein_id|YP_005355600.1, gi|383329716, geneID|11955785
2487 2427488 2426802 687 - 2         Phage protein locus|EFAU004_02400, protein_id|YP_005355601.1, gi|383329717, geneID|11955786
2488 2427970 2427494 477 - 5         Phage protein locus|EFAU004_02401, protein_id|YP_005355602.1, gi|383329718, geneID|11955787
2489 2428300 2428434 135 + 329         hypothetical protein  
2490 2428607 2428431 177 - -4         hypothetical protein locus|EFAU004_02402, protein_id|YP_005355603.1, gi|383329719, geneID|11955788
2491 2428729 2428604 126 - -4         FIG00631505: hypothetical protein locus|EFAU004_02403, protein_id|YP_005355604.1, gi|383329720, geneID|11955789
2492 2428871 2428698 174 - -32         hypothetical protein locus|EFAU004_02404, protein_id|YP_005355605.1, gi|383329721, geneID|11955790
2493 2429056 2428868 189 - -4         FIG00629649: hypothetical protein locus|EFAU004_02405, protein_id|YP_005355606.1, gi|383329722, geneID|11955791
2494 2429361 2429077 285 - 20         FIG00630724: hypothetical protein locus|EFAU004_02406, protein_id|YP_005355607.1, gi|383329723, geneID|11955792
2495 2429708 2429409 300 - 47         FIG00629011: hypothetical protein locus|EFAU004_02407, protein_id|YP_005355608.1, gi|383329724, geneID|11955793
2496 2430016 2429813 204 - 104         Helix-turn-helix domain protein locus|EFAU004_02408, protein_id|YP_005355609.1, gi|383329725, geneID|11955794
2497 2430777 2430031 747 - 14       Phage antirepressor protein locus|EFAU004_02409, protein_id|YP_005355610.1, gi|383329726, geneID|11955795
2498 2430855 2431163 309 + 77         hypothetical protein locus|EFAU004_02410, protein_id|YP_005355611.1, gi|383329727, geneID|11955796
2499 2431391 2431134 258 - -30         hypothetical protein locus|EFAU004_02411, protein_id|YP_005355612.1, gi|383329728, geneID|11955797
2500 2431829 2431689 141 - 297         hypothetical protein locus|EFAU004_02412, protein_id|YP_005355613.1, gi|383329729, geneID|11955798
2501 2432123 2432443 321 + 293 4     Helix-turn-helix motif locus|EFAU004_02413, protein_id|YP_005355614.1, gi|383329730, geneID|11955799
2502 2432461 2432892 432 + 17         Protein of unknown function DUF955 locus|EFAU004_02414, protein_id|YP_005355615.1, gi|383329731, geneID|11955800
2503 2433019 2433603 585 + 126         hypothetical protein locus|EFAU004_02415, protein_id|YP_005355616.1, gi|383329732, geneID|11955801
2504 2433714 2434853 1140 + 110         Phage integrase gene_name|xerC, locus|EFAU004_02416, protein_id|YP_005355617.1, gi|383329733, geneID|11955802
2505 2436567 2434942 1626 - 88     1: 1   Heat shock protein 60 family chaperone GroEL gene_name|groL, locus|EFAU004_02417, protein_id|YP_005355618.1, gi|383329734, geneID|11955803

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|1155766.14.peg.2497 Phage antirepressor protein
MNTPQIFNFEQNEVRTILVNDEPYFVGKDVADVLGYSNPQKAIRDHVDLEDKTQNDSFTV
NGTAVVLINESGLYSLILKSKLPSAKKFKRWVTSEVLPTIRKTGSYSNVPQSFAQALRLA
ADLEEKNQLLEQQIAEYEPKISYLDTILSSTDTVATSQIAADYGMSAIALNKLLNELGVQ
HKVSGQWILYRKHMNQGYTKSHTSEIPKADGGTKVVMNTKWTQKGRVFIYNLLIAEGYYP
QMDLEEIG

MD5 = e4fd32996878fa2bbc478f204b99d35f


  DNA Sequence

>fig|1155766.14.peg.2497 Phage antirepressor protein
atgaatacaccacaaatttttaatttcgagcaaaacgaagttcgaactattttagtaaat
gatgaaccatattttgtaggaaaagatgtagcagacgttctaggatattcgaatccgcaa
aaagctattcgagatcatgtggacttggaggataagacgcagaacgattcgttcaccgtc
aatggaacagcagttgttttgattaacgagtcaggcctttacagtttaatcttaaaatca
aaacttccctctgccaaaaaatttaaacgttgggtaacgagtgaagtccttccaacaatt
agaaaaacaggtagctattcaaacgtacctcaaagttttgcacaagcattgcgtttagca
gcggatttagaagaaaagaaccaattactcgaacaacaaattgccgagtacgaaccaaag
attagctacttagatacgattctttcatcgacagatacggtagctacttctcaaattgca
gctgattacggaatgtcggcaattgctctaaacaaattgctaaacgagttaggtgttcag
cataaagttagcggacaatggatactttaccgaaaacatatgaaccaaggatacacaaaa
tcgcacacaagtgagataccgaaagccgatggcggcactaaagttgtaatgaataccaaa
tggacacagaaagggcgagtgtttatttacaacttattaatcgcagagggctattaccct
caaatggatttagaggaaattggttag


  DNA with Flanking Sequence

>fig|1155766.14.peg.2497 Phage antirepressor protein
aaggatgcaaaaatgcttctcaagactatcaactttgaaatgaatccaacaaaaagaaag
ctcgccgatgtgttggaagaaaagttggcttccgctatcaacgagcaagaattactattt
gaaaccgatacttttaacagctgatgttttatagatgacagtttcatccgaatctatatc
atcgccgagagaaaagaatgttgcttttgacaaaaagccgataagacctacaagcggtct
tgatgttgcaagagtagataccccaatatcaccttgcaaggtattcacgtaaatttgaga
agaatagaacattccatctttttcttcgatatttgacgcatcatcgtatccaacgaccaa
agtatcggcaaatattttgattttttctccatcaagcatagtaattacaaattctggttt
cataaattttcacctccttaacaattatttcagcctgtcacactgataaggaaattatac
caaagaaaggaatgagaaatatgaatacaccacaaatttttaatttcgagcaaaacgaag
ttcgaactattttagtaaatgatgaaccatattttgtaggaaaagatgtagcagacgttc
taggatattcgaatccgcaaaaagctattcgagatcatgtggacttggaggataagacgc
agaacgattcgttcaccgtcaatggaacagcagttgttttgattaacgagtcaggccttt
acagtttaatcttaaaatcaaaacttccctctgccaaaaaatttaaacgttgggtaacga
gtgaagtccttccaacaattagaaaaacaggtagctattcaaacgtacctcaaagttttg
cacaagcattgcgtttagcagcggatttagaagaaaagaaccaattactcgaacaacaaa
ttgccgagtacgaaccaaagattagctacttagatacgattctttcatcgacagatacgg
tagctacttctcaaattgcagctgattacggaatgtcggcaattgctctaaacaaattgc
taaacgagttaggtgttcagcataaagttagcggacaatggatactttaccgaaaacata
tgaaccaaggatacacaaaatcgcacacaagtgagataccgaaagccgatggcggcacta
aagttgtaatgaataccaaatggacacagaaagggcgagtgtttatttacaacttattaa
tcgcagagggctattaccctcaaatggatttagaggaaattggttagaaaggagttttag
tatgactgacattgcagaaatcactcaacgagatagagaaaaaatcaaagaatatgtcga
aagttcaaagttcttaacttacaccatgcttgctgaaagatttggaattagcaaaagcta
cttatctttaattttaaacggtaaaaagacttctgcagaagcaaacagaattatagattc
gattatcactatgtacgaattgtagagggaggtaaagtcgttggaagataaaatcattct
tacaaaatcagagcttcaagaaatgttaaacatcgagtatggaacgataatttttaggag
ggataataagtgaaaaaaccaacactttcagagttgatagaagctgctgagaaggcagta
aaaccagacgactggtaccgacaaagtttaatcttggagaagttccacggcatgtcaaaa
actactttagttgaatactgcaaggaaatggaaacaattcctgaattttcagaaggaatt
gttcgtc


  Assignments for Essentially Identical Proteins

No essentially identical proteins found

  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function
4 fig|1155766.14.peg.2501 Helix-turn-helix motif


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search