The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|1155766.14.peg.2484: Enterococcus faecium Aus0004

This feature in The SEED Viewer

NCBI Taxonomy Id: 1155766

Current Assignment: FIG00631516: hypothetical protein
Translate Function Assignments



Context on contig NC_017022 from base 2420350 to 2430777 (10428 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
2474 2420631 2420350 282 -           FIG00627340: hypothetical protein locus|EFAU004_02383, protein_id|YP_005355584.1, gi|383329700, geneID|11955769
2475 2422305 2421889 417 - 1257         Phage transcriptional activator ArpU locus|EFAU004_02386, protein_id|YP_005355587.1, gi|383329703, geneID|11955772
2476 2422513 2422382 132 - 76         hypothetical protein locus|EFAU004_02387, protein_id|YP_005355588.1, gi|383329704, geneID|11955773
2477 2422646 2422503 144 - -11         hypothetical protein locus|EFAU004_02388, protein_id|YP_005355589.1, gi|383329705, geneID|11955774
2478 2422960 2422643 318 - -4         FIG00631129: hypothetical protein locus|EFAU004_02389, protein_id|YP_005355590.1, gi|383329706, geneID|11955775
2479 2423160 2422957 204 - -4         FIG00630572: hypothetical protein locus|EFAU004_02390, protein_id|YP_005355591.1, gi|383329707, geneID|11955776
2480 2424024 2423851 174 - 690         hypothetical protein locus|EFAU004_02393, protein_id|YP_005355594.1, gi|383329710, geneID|11955779
2481 2424581 2424021 561 - -4         conserved hypothetical protein - phage associated locus|EFAU004_02394, protein_id|YP_005355595.1, gi|383329711, geneID|11955780
2482 2424994 2424578 417 - -4         FIG00631830: hypothetical protein locus|EFAU004_02395, protein_id|YP_005355596.1, gi|383329712, geneID|11955781
2483 2425308 2424991 318 - -4         Phage protein locus|EFAU004_02396, protein_id|YP_005355597.1, gi|383329713, geneID|11955782
2484 2425607 2425308 300 - -1         FIG00631516: hypothetical protein locus|EFAU004_02397, protein_id|YP_005355598.1, gi|383329714, geneID|11955783
2485 2425764 2425600 165 - -8         FIG00632008: hypothetical protein  
2486 2426799 2426050 750 - 285         Phage replication initiation locus|EFAU004_02399, protein_id|YP_005355600.1, gi|383329716, geneID|11955785
2487 2427488 2426802 687 - 2         Phage protein locus|EFAU004_02400, protein_id|YP_005355601.1, gi|383329717, geneID|11955786
2488 2427970 2427494 477 - 5         Phage protein locus|EFAU004_02401, protein_id|YP_005355602.1, gi|383329718, geneID|11955787
2489 2428300 2428434 135 + 329         hypothetical protein  
2490 2428607 2428431 177 - -4         hypothetical protein locus|EFAU004_02402, protein_id|YP_005355603.1, gi|383329719, geneID|11955788
2491 2428729 2428604 126 - -4         FIG00631505: hypothetical protein locus|EFAU004_02403, protein_id|YP_005355604.1, gi|383329720, geneID|11955789
2492 2428871 2428698 174 - -32         hypothetical protein locus|EFAU004_02404, protein_id|YP_005355605.1, gi|383329721, geneID|11955790
2493 2429056 2428868 189 - -4         FIG00629649: hypothetical protein locus|EFAU004_02405, protein_id|YP_005355606.1, gi|383329722, geneID|11955791
2494 2429361 2429077 285 - 20         FIG00630724: hypothetical protein locus|EFAU004_02406, protein_id|YP_005355607.1, gi|383329723, geneID|11955792
2495 2429708 2429409 300 - 47         FIG00629011: hypothetical protein locus|EFAU004_02407, protein_id|YP_005355608.1, gi|383329724, geneID|11955793
2496 2430016 2429813 204 - 104         Helix-turn-helix domain protein locus|EFAU004_02408, protein_id|YP_005355609.1, gi|383329725, geneID|11955794
2497 2430777 2430031 747 - 14         Phage antirepressor protein locus|EFAU004_02409, protein_id|YP_005355610.1, gi|383329726, geneID|11955795

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|1155766.14.peg.2484 FIG00631516: hypothetical protein
MDKKAAMKRIIELTHSENWQEDKEIVTEVQKLGKSMWTEKPKRRTPRKIAIWHGDRILVT
GTAEQLSEITGLSKNIIWDRARSLWIDSKGRQFRYVEEK

MD5 = dc9693ce02c7457d926e84688bb6de68


  DNA Sequence

>fig|1155766.14.peg.2484 FIG00631516: hypothetical protein
atggataagaaagcggcaatgaaacgaatcatcgaactgacacattctgagaattggcaa
gaagacaaagaaatagttacagaagtccaaaagctcggtaaatcaatgtggactgaaaag
cccaaacggagaacgccaagaaaaattgcaatctggcatggtgatcgaattctagtaaca
ggtactgctgaacagttatctgaaattactggattaagcaaaaacatcatctgggataga
gctaggagcttatggattgattcaaaaggacgacagtttaggtatgtggaggagaaataa


  DNA with Flanking Sequence

>fig|1155766.14.peg.2484 FIG00631516: hypothetical protein
ctatctcaagaaaaaagcgctagaacgagctaatagacaatcaaaagcaccattttaaga
ggtggaaaattgaaaatcgattatctagaactaattaatgaaatagcgaattataaaact
ggcgaggaaatagacatcctgagagacgtatatgatcaactcgaagaagctggaatcgaa
ggaattaataatgatcgttcgagttggagtaaactcagatactatttcgcactctatatc
gatacaacacaattaagaaatttagcttatacaaaattactatttgttgattgcattaaa
ggattgcaaaaacatcttagtgaactcgagcgggtgtaatcagatggacctaaagacatt
tacagcacagatcgaactaatgcatcaagaagctttaagacaaagcgcctcgtacgaaga
caagtggctcaacacgttccatggtggacgtgagagcgcacttgatcaagtactcaaatt
attgaaaggggaacgtcgggatggataagaaagcggcaatgaaacgaatcatcgaactga
cacattctgagaattggcaagaagacaaagaaatagttacagaagtccaaaagctcggta
aatcaatgtggactgaaaagcccaaacggagaacgccaagaaaaattgcaatctggcatg
gtgatcgaattctagtaacaggtactgctgaacagttatctgaaattactggattaagca
aaaacatcatctgggatagagctaggagcttatggattgattcaaaaggacgacagttta
ggtatgtggaggagaaataatggatctcattacacaatatagtgatatcatcctcaagaa
aatcatgatgaagattcagaaagacaaaaaatcaaaagaacgagcggaattagttaagtt
ggaaatggctgaaacaggagcaggagtgcgaagtagcaggcattggaaagcagcagcaaa
cattgaattttattacaacgaaattcaaaaagggttcgatcagatgcgtgagctggatcg
gcaaacaaattggagcaagaaacttcatcaagatcgtttcaaatttgtagagaaatataa
agagatattagacgaatacaaggaggacagcaaatgataccgaagtttagagcgtgggat
aaaaaaacagaaactatacaagagatagaatcaatatctttcaaagaaaaaaagctagtg
attgatcaaaaatctgtcacttggttcaactcggattatattagaaactttggcgaagtt
gaactcatgcaatccacaggactgaaagataagaatggtg


  Assignments for Essentially Identical Proteins

No essentially identical proteins found

  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search