The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|1155766.14.peg.1506: Enterococcus faecium Aus0004

This feature in The SEED Viewer

NCBI Taxonomy Id: 1155766

Current Assignment: Phage antirepressor protein
Translate Function Assignments



Context on contig NC_017022 from base 1484002 to 1495054 (11053 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1496 1484166 1484002 165 -           FIG00632008: hypothetical protein locus|EFAU004_01447, protein_id|YP_005354649.1, gi|383328765, geneID|11957120
1497 1485201 1484452 750 - 285         Phage replication initiation locus|EFAU004_01449, protein_id|YP_005354651.1, gi|383328767, geneID|11954821
1498 1485890 1485204 687 - 2         Phage protein locus|EFAU004_01450, protein_id|YP_005354652.1, gi|383328768, geneID|11954822
1499 1486567 1485896 672 - 5         Phage protein locus|EFAU004_01451, protein_id|YP_005354653.1, gi|383328769, geneID|11954823
1500 1486901 1486560 342 - -8         FIG00627384: hypothetical protein locus|EFAU004_01452, protein_id|YP_005354654.1, gi|383328770, geneID|11954824
1501 1487086 1486958 129 - 56         hypothetical protein  
1502 1487777 1487079 699 - -8         Uncharacterized phage-encoded protein-like locus|EFAU004_01453, protein_id|YP_005354655.1, gi|383328771, geneID|11954825
1503 1488556 1488377 180 - 599         FIG00631288: hypothetical protein locus|EFAU004_01455, protein_id|YP_005354657.1, gi|383328773, geneID|11954827
1504 1488881 1488543 339 - -14         hypothetical protein locus|EFAU004_01456, protein_id|YP_005354658.1, gi|383328774, geneID|11954828
1505 1489100 1488897 204 - 15         Helix-turn-helix domain protein locus|EFAU004_01457, protein_id|YP_005354659.1, gi|383328775, geneID|11954829
1506 1489891 1489115 777 - 14       Phage antirepressor protein locus|EFAU004_01458, protein_id|YP_005354660.1, gi|383328776, geneID|11954830
1507 1490190 1490510 321 + 298 5     Helix-turn-helix motif locus|EFAU004_01459, protein_id|YP_005354661.1, gi|383328777, geneID|11954831
1508 1490528 1490959 432 + 17         Protein of unknown function DUF955 locus|EFAU004_01460, protein_id|YP_005354662.1, gi|383328778, geneID|11954832
1509 1491259 1491549 291 + 299         hypothetical protein locus|EFAU004_01462, protein_id|YP_005354664.1, gi|383328780, geneID|11954834
1510 1491583 1492218 636 + 33         hypothetical protein locus|EFAU004_01463, protein_id|YP_005354665.1, gi|383328781, geneID|11954835
1511 1492331 1492966 636 + 112         FIG00632072: hypothetical protein locus|EFAU004_01464, protein_id|YP_005354666.1, gi|383328782, geneID|11954836
1512 1493265 1494404 1140 + 298         Phage integrase gene_name|xerC, locus|EFAU004_01466, protein_id|YP_005354668.1, gi|383328784, geneID|11954838
1513 1495054 1494497 558 - 92         General stress protein, Gls24 family locus|EFAU004_01467, protein_id|YP_005354669.1, gi|383328785, geneID|11954839

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|1155766.14.peg.1506 Phage antirepressor protein
MNTPQIFNFEQNEVRTILVNDEPYFVGKDVASVLGYSNTKDALSRHVDLEDKMGSRITTS
GQSREMTIINESGLYSLILKSKLPSAKKFKRWVTSEVLPAIRKHGGYLTPEKVEEALLNP
DTIIQLATQLKEERTGRLIAEQKIAEYEPKISYLDSILSSTDSVTISQIAADYGMSPQQM
NKLLHKLGIQKKVGNQWLLCKKHMNQGYTKSHTTEIPKADGGTKIVMNTKWTQKGRLFIY
ELLKKEGYYPQMDLEEIG

MD5 = 0cabfd7b06f8e58d99fd40704c2854a6


  DNA Sequence

>fig|1155766.14.peg.1506 Phage antirepressor protein
atgaacacaccgcaaatttttaatttcgaacaaaacgaagttcggacaattttagtaaat
gatgaaccatattttgtaggcaaagacgttgcgagtgttttgggttattcaaacactaaa
gatgctttgtcgcggcatgtagatttggaagataagatggggtcgcgaatcacgacctca
ggtcaatcaagagagatgacaatcatcaacgaatctggtttgtacagtttaatcttaaaa
tcaaaacttccctctgccaaaaaatttaaacgttgggtaacaagtgaagtgttgccagca
attagaaaacatggaggttatctaactccagaaaaagtagaagaagctttgcttaatcca
gatacaatcattcaattagcaactcaactaaaagaagaaagaactggaagattaatcgca
gaacaaaagattgcagagtacgaacctaaaatctcctatttagatagcatattatcttct
acagattcagtaacaattagtcagattgcagcagattatgggatgtctccacaacagatg
aataaattacttcataaactaggtattcagaaaaaagtcggtaaccaatggttattgtgc
aaaaaacacatgaaccaaggatacacaaaatctcatacaactgagatcccgaaagccgat
ggtggcactaaaattgtaatgaataccaaatggacacagaaagggcgtctatttatctac
gaattactaaaaaaagaaggatattaccctcaaatggatttagaggaaattggttag


  DNA with Flanking Sequence

>fig|1155766.14.peg.1506 Phage antirepressor protein
gggtttctctttcttctctacctagaaggtagtctacagagacatcgaaatagtcagcaa
tccgacttaattcatctgaattaggagtattatttttccactttgctagataaccgttag
aatatccaaaattaatttctaactgccgtatagatatctttttcctcttcgccaagtctt
ttattatttcataggtattcatcgataaaacaacctttctaaatgtttacaaaaaaagtt
tagaaaaatacgcagaaataatttgactaattctgagtaatgagctatactatatcttgt
aaacagatttaacaactaaaaagacaacaaaaaacactattgatatgtaaatgcagaccg
ccaagaaagctttaaaatcaatgtttttatgtcttatttaattatgctcttagtatagag
tattactcagatactgtcaattgaatttagaaaaaagttgttaaatttgtttacgaatat
aaaagaaaggaatgagaaatatgaacacaccgcaaatttttaatttcgaacaaaacgaag
ttcggacaattttagtaaatgatgaaccatattttgtaggcaaagacgttgcgagtgttt
tgggttattcaaacactaaagatgctttgtcgcggcatgtagatttggaagataagatgg
ggtcgcgaatcacgacctcaggtcaatcaagagagatgacaatcatcaacgaatctggtt
tgtacagtttaatcttaaaatcaaaacttccctctgccaaaaaatttaaacgttgggtaa
caagtgaagtgttgccagcaattagaaaacatggaggttatctaactccagaaaaagtag
aagaagctttgcttaatccagatacaatcattcaattagcaactcaactaaaagaagaaa
gaactggaagattaatcgcagaacaaaagattgcagagtacgaacctaaaatctcctatt
tagatagcatattatcttctacagattcagtaacaattagtcagattgcagcagattatg
ggatgtctccacaacagatgaataaattacttcataaactaggtattcagaaaaaagtcg
gtaaccaatggttattgtgcaaaaaacacatgaaccaaggatacacaaaatctcatacaa
ctgagatcccgaaagccgatggtggcactaaaattgtaatgaataccaaatggacacaga
aagggcgtctatttatctacgaattactaaaaaaagaaggatattaccctcaaatggatt
tagaggaaattggttagaaaggagttttagtatgactgacattgcagaaatcactcaacg
agatagagaaaaaatcaaagaatatgtcgaaagttcaaagttcttaacttacaccatgct
tgctgaaagatttggaattagcaaaagctacttatctttaattttaaacggtaaaaagac
ttctgcagaagcaaacagaattatagattcgattatcactatgtacgaattgtaaaggga
ggaacagctaatgcaatatctagaagcaaaaatcccaattccagaaggctatgtaattat
ctcccaagtggattatgaggagttaaaaaaagctgatgatactggtagatggatgacgtt
gccagaagtgctagaacggattaacagaaaatatgattggtttacttctagagttttaaa
gaacccaagatatagaaatattatcgatatcgagaaaaacaaaaatggatttgtctatta
tccagttgaaggaagagacacatatctatttttaaga


  Assignments for Essentially Identical Proteins

No essentially identical proteins found

  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function
5 fig|1155766.14.peg.1507 Helix-turn-helix motif


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search