The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|1125636.3.peg.4316: Escherichia coli 2854350

This feature in The SEED Viewer

NCBI Taxonomy Id: 1125636

Current Assignment: ATP-dependent DNA helicase Rep
Translate Function Assignments



Context on contig APZL01000139 from base 8720 to 21292 (12573 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
4310 8720 10264 1545 +       1: 1   Threonine dehydratase biosynthetic (EC 4.3.1.19) locus|EC2854350_4139, protein_id|END37821.1, gi|477055057
4311 11209 10316 894 - 51         Transcriptional regulator IlvY, LysR family locus|EC2854350_4140, protein_id|END37822.1, gi|477055058
4312 11359 11850 492 + 149     2: 1 2   Ketol-acid reductoisomerase (EC 1.1.1.86) locus|EC2854350_4141, protein_id|END37823.1, gi|477055059
4313 11920 12834 915 + 69     2: 1 2   Ketol-acid reductoisomerase (EC 1.1.1.86) gene_name|ilvC, locus|EC2854350_4142, protein_id|END37824.1, gi|477055060
4314 13202 12921 282 - 86       dlit(8163020) Peptidyl-prolyl cis-trans isomerase PpiC (EC 5.2.1.8) gene_name|ppiC, locus|EC2854350_4143, protein_id|END37825.1, gi|477055061
4315 13850 13401 450 - 198         FIG00642180: hypothetical protein locus|EC2854350_4144, protein_id|END37826.1, gi|477055062
4316 14067 16088 2022 + 216         ATP-dependent DNA helicase Rep gene_name|rep, locus|EC2854350_4145, protein_id|END37827.1, gi|477055063
4317 17619 16135 1485 - 46         Guanosine-5'-triphosphate,3'-diphosphate pyrophosphatase (EC 3.6.1.40) @ Exopolyphosphatase (EC 3.6.1.11) locus|EC2854350_4146, protein_id|END37828.1, gi|477055064
4318 19018 17753 1266 - 133       dlit(8610017)
dlit(12181321)
ATP-dependent RNA helicase RhlB (EC 3.6.4.13) gene_name|rhlB, locus|EC2854350_4147, protein_id|END37829.1, gi|477055065
4319 19149 19478 330 + 130     2: 4 3 dlit(1094461)
dlit(2181145)
dlit(6098320)
dlit(1561103)
dlit(4883076)
dlit(6099324)
dlit(3891733)
Thioredoxin locus|EC2854350_4148, protein_id|END37830.1, gi|477055066
4320 19805 21064 1260 + 326       dlit(7828920)
dlit(10230401)
dlit(6304634)
dlit(9586995)
dlit(8466900)
Transcription termination factor Rho gene_name|rho, locus|EC2854350_4149, protein_id|END37831.1, gi|477055067
4321 21074 21292 219 + 9         Putative phosphotransferase enzyme IIB component SgcB locus|EC2854350_4150, protein_id|END37832.1, gi|477055068

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|1125636.3.peg.4316 ATP-dependent DNA helicase Rep
MRLNPGQQQAVEFVTGPCLVLAGAGSGKTRVITNKIAHLIRGCGYQARHIAAVTFTNKAA
REMKERVGQTLGRKEARGLMISTFHTLGLDIIKREYAALGMKANFSLFDDTDQLALLKEL
TEGLIEDDKVLLQQLISTISNWKNNLKTPAQAAAEAKGERDRIFAHCYGLYDAHLKACNV
LDFDDLILLPTLLLQRNEEVRERWQNKIRYLLVDEYQDTNTSQYELVKLLVGSRARFTVV
GDDDQSIYSWRGARPQNLVLLSQDFPALKVIKLEQNYRSSGRILKAANILIANNPHVFEK
RLFSELGYGTELKVLSANNEEHEAERVTGELIAHHFVNKTQYKDYAILYRGNHQSRVFEK
FLMQNRIPYKISGGTSFFSRPEIKDLLAYLRVLTNPDDDSAFLRIVNTPKREIGPATLKK
LGEWAMTRNKSMFTASFDMGLSQTLSGRGYEALTRFTHWLAEIQRLAEREPIAAVRDLIH
GMDYESWLYETSPSPKAAEMRMKNVNQLFSWMTEMLEGSELDEPMTLTQVVTRFTLRDMM
ERGESEEELDQVQLMTLHASKGLEFPYVYMVGMEEGFLPHQSSIDEDNIDEERRLAYVGI
TRAQKELTFTLCKERRQYGELVRPEPSRFLLELPQDDLIWEQERKVVSAEERMQKGQSHL
ANLKAMMAAKRGK

MD5 = b488c45242c46db5c52dab3d1856e7ae


  DNA Sequence

>fig|1125636.3.peg.4316 ATP-dependent DNA helicase Rep
atgcgtctaaaccccggccaacaacaagctgtcgaattcgttaccggcccctgcctggtg
ctggcgggcgcggggtccggtaaaactcgtgtgatcaccaataaaatcgcccatctgatc
cgcggttgcggttatcaggcgcgacatatcgcggcggtgacctttaccaataaggcggcg
cgcgagatgaaagagcgtgtcgggcagacgctgggtcgcaaagaggcgcgcgggctgatg
atctccacttttcacacgctggggttggatatcatcaaacgcgagtatgcggcgcttggg
atgaaggcgaacttttcgctgtttgacgataccgatcagcttgctttgcttaaagagttg
accgaggggctgattgaagatgacaaagttctcctgcaacagctgatttcgaccatctcc
aactggaagaacaatctcaaaactccggcgcaggcggcggcagaggcaaagggcgagcgg
gatcgtatttttgcccattgttatgggctgtatgatgcacacctgaaagcgtgcaatgtt
ctcgacttcgatgatctgattttattgccgacgttgctgctgcaacgcaatgaagaagtc
cgcgagcgctggcagaacaaaattcgctatctgctggtggatgagtatcaggacacaaac
accagccagtatgagctggtgaaactgctggtgggcagccgcgcgcgctttaccgtggtg
ggcgatgacgaccagtcgatctactcctggcgcggcgcacgtccacaaaacctggtgctg
ctgagtcaggattttccggcgctgaaggtgattaagcttgagcagaactaccgctcttcc
ggacgtattttgaaagcggcgaacatcctgatcgccaataacccgcacgtctttgagaag
cgtctgttctccgaactgggttacggcacagagcttaaagttttaagcgcgaataacgaa
gaacatgaagccgagcgcgtcactggtgaactgattgcgcatcacttcgtcaataaaacg
cagtacaaagattacgctattctttatcgcggtaaccatcagtcgcgagtgtttgaaaaa
ttcctgatgcaaaaccgcatcccgtacaaaatttctggtggtacgtcgtttttctctcgt
cctgaaatcaaggacttgctggcttatctgcgcgtgctgactaacccggacgatgacagc
gcatttctgcgtatcgttaacacgccgaagagagagattggcccggcgacgctgaaaaag
ctgggtgagtgggcgatgacgcgcaataaaagcatgtttaccgccagctttgatatgggc
ctgagtcagacgcttagcggacgtggttatgaagcattgacccgctttactcactggttg
gcagaaatccagcgtctggcggagcgggagccgattgccgcggtgcgcgatctgatccac
ggcatggattatgaatcctggctgtacgaaacatcgcccagcccgaaagccgccgaaatg
cgcatgaagaacgtcaaccaactgtttagctggatgacggagatgctggaaggcagcgaa
ctggatgagccgatgacgctcacccaggtggtgacgcgctttactttgcgcgacatgatg
gagcgtggtgagagtgaagaagagctggatcaggtgcaactgatgactctgcacgcgtca
aaagggctggagtttccttatgtctacatggtcggtatggaagaagggtttttgccgcac
cagagcagcatcgatgaagataatatcgatgaggagcggcggctggcctatgtcggcatt
acccgcgcccagaaggaattgacctttacgctgtgtaaagaacgccgtcagtacggcgag
ctggtgcgcccggagccgagccgctttttgctggagctgccgcaggatgatctgatttgg
gaacaggagcgcaaagtggtcagcgccgaagaacggatgcagaaagggcaaagccatctg
gcgaatctgaaagcgatgatggcggcaaaacgagggaaataa


  DNA with Flanking Sequence

>fig|1125636.3.peg.4316 ATP-dependent DNA helicase Rep
tgctgatcaaagaattgcaggacattgataacattactggctatttcaacatgcattcca
cgatttaacttgtcatgatcgcgagtggttgataatggaacgacgatacatgcgttgcca
ttaatttttccgttgagcacgacaactaacctgttttttatcatttcaggaggaatgcgg
ccatcgtaatacgtggtgctgaactgtccattctggataacaggatagttaccaaagttg
cattcctgtatttcaccaaccttagggctgaaattaatcgccacgagtaaacctctcctt
agtaaactctgaaaaagtaataacacaacgttacgacccgatattttctaagtctaatgg
attcacgatgaactccgatttcggtcttctctctctgatttaaacatccgcagccaaccg
gttagcggcttacacgcggtcacattcaaatgcgattctgctacaatcctccccccgttc
gaagattgagcaatacacctatgcgtctaaaccccggccaacaacaagctgtcgaattcg
ttaccggcccctgcctggtgctggcgggcgcggggtccggtaaaactcgtgtgatcacca
ataaaatcgcccatctgatccgcggttgcggttatcaggcgcgacatatcgcggcggtga
cctttaccaataaggcggcgcgcgagatgaaagagcgtgtcgggcagacgctgggtcgca
aagaggcgcgcgggctgatgatctccacttttcacacgctggggttggatatcatcaaac
gcgagtatgcggcgcttgggatgaaggcgaacttttcgctgtttgacgataccgatcagc
ttgctttgcttaaagagttgaccgaggggctgattgaagatgacaaagttctcctgcaac
agctgatttcgaccatctccaactggaagaacaatctcaaaactccggcgcaggcggcgg
cagaggcaaagggcgagcgggatcgtatttttgcccattgttatgggctgtatgatgcac
acctgaaagcgtgcaatgttctcgacttcgatgatctgattttattgccgacgttgctgc
tgcaacgcaatgaagaagtccgcgagcgctggcagaacaaaattcgctatctgctggtgg
atgagtatcaggacacaaacaccagccagtatgagctggtgaaactgctggtgggcagcc
gcgcgcgctttaccgtggtgggcgatgacgaccagtcgatctactcctggcgcggcgcac
gtccacaaaacctggtgctgctgagtcaggattttccggcgctgaaggtgattaagcttg
agcagaactaccgctcttccggacgtattttgaaagcggcgaacatcctgatcgccaata
acccgcacgtctttgagaagcgtctgttctccgaactgggttacggcacagagcttaaag
ttttaagcgcgaataacgaagaacatgaagccgagcgcgtcactggtgaactgattgcgc
atcacttcgtcaataaaacgcagtacaaagattacgctattctttatcgcggtaaccatc
agtcgcgagtgtttgaaaaattcctgatgcaaaaccgcatcccgtacaaaatttctggtg
gtacgtcgtttttctctcgtcctgaaatcaaggacttgctggcttatctgcgcgtgctga
ctaacccggacgatgacagcgcatttctgcgtatcgttaacacgccgaagagagagattg
gcccggcgacgctgaaaaagctgggtgagtgggcgatgacgcgcaataaaagcatgttta
ccgccagctttgatatgggcctgagtcagacgcttagcggacgtggttatgaagcattga
cccgctttactcactggttggcagaaatccagcgtctggcggagcgggagccgattgccg
cggtgcgcgatctgatccacggcatggattatgaatcctggctgtacgaaacatcgccca
gcccgaaagccgccgaaatgcgcatgaagaacgtcaaccaactgtttagctggatgacgg
agatgctggaaggcagcgaactggatgagccgatgacgctcacccaggtggtgacgcgct
ttactttgcgcgacatgatggagcgtggtgagagtgaagaagagctggatcaggtgcaac
tgatgactctgcacgcgtcaaaagggctggagtttccttatgtctacatggtcggtatgg
aagaagggtttttgccgcaccagagcagcatcgatgaagataatatcgatgaggagcggc
ggctggcctatgtcggcattacccgcgcccagaaggaattgacctttacgctgtgtaaag
aacgccgtcagtacggcgagctggtgcgcccggagccgagccgctttttgctggagctgc
cgcaggatgatctgatttgggaacaggagcgcaaagtggtcagcgccgaagaacggatgc
agaaagggcaaagccatctggcgaatctgaaagcgatgatggcggcaaaacgagggaaat
aatcaaggccggaaaagatgcgtcagcatcgcatccggcacttactcattaatgcacttc
cagcggccagtggacatagctctgccactggctttcctgagcaataatctctttacccag
cggatgttgggttagccaaccttgcggaagcgtcaaggtcaacagttcatggttagcctg
taatgtcatctctggcacgagatcgtcacggcgacggctggcaaaaatgatggccaggcg
gagtaaacggcagagttgttctgcgacgcgcggagggacggcattttgctgatgcagcga
tgagagatcgaccggattagtctggttgagcagtagcgtcgccagcaattttttctgtgc
gggggtaaaaccgggaagatccagattacgcaccagataagcagcgtgttgcggcgcttg
tttaaagtcaacgctcaggccgatttcatgaagctgacaggcgctgatgagcaaatcgcg
gcttattgcttcaagatgccat


  Assignments for Essentially Identical Proteins

No essentially identical proteins found

  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search