The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|1125636.3.peg.4314: Escherichia coli 2854350

This feature in The SEED Viewer

NCBI Taxonomy Id: 1125636

Current Assignment: Peptidyl-prolyl cis-trans isomerase PpiC (EC 5.2.1.8)
Translate Function Assignments



Context on contig APZL01000139 from base 6867 to 19018 (12152 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
4309 6867 8717 1851 +       1: 1   Dihydroxy-acid dehydratase (EC 4.2.1.9) gene_name|ilvD, locus|EC2854350_4138, protein_id|END37820.1, gi|477055056
4310 8720 10264 1545 + 2     1: 1   Threonine dehydratase biosynthetic (EC 4.3.1.19) locus|EC2854350_4139, protein_id|END37821.1, gi|477055057
4311 11209 10316 894 - 51         Transcriptional regulator IlvY, LysR family locus|EC2854350_4140, protein_id|END37822.1, gi|477055058
4312 11359 11850 492 + 149     2: 1 2   Ketol-acid reductoisomerase (EC 1.1.1.86) locus|EC2854350_4141, protein_id|END37823.1, gi|477055059
4313 11920 12834 915 + 69     2: 1 2   Ketol-acid reductoisomerase (EC 1.1.1.86) gene_name|ilvC, locus|EC2854350_4142, protein_id|END37824.1, gi|477055060
4314 13202 12921 282 - 86       dlit(8163020) Peptidyl-prolyl cis-trans isomerase PpiC (EC 5.2.1.8) gene_name|ppiC, locus|EC2854350_4143, protein_id|END37825.1, gi|477055061
4315 13850 13401 450 - 198         FIG00642180: hypothetical protein locus|EC2854350_4144, protein_id|END37826.1, gi|477055062
4316 14067 16088 2022 + 216         ATP-dependent DNA helicase Rep gene_name|rep, locus|EC2854350_4145, protein_id|END37827.1, gi|477055063
4317 17619 16135 1485 - 46         Guanosine-5'-triphosphate,3'-diphosphate pyrophosphatase (EC 3.6.1.40) @ Exopolyphosphatase (EC 3.6.1.11) locus|EC2854350_4146, protein_id|END37828.1, gi|477055064
4318 19018 17753 1266 - 133       dlit(8610017)
dlit(12181321)
ATP-dependent RNA helicase RhlB (EC 3.6.4.13) gene_name|rhlB, locus|EC2854350_4147, protein_id|END37829.1, gi|477055065

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|1125636.3.peg.4314 Peptidyl-prolyl cis-trans isomerase PpiC (EC 5.2.1.8)
MAKTAAALHILVKEEKLALDLLEQIKNGADFGKLAKKHSICPSGKRGGDLGEFRQGQMVP
AFDKVVFSCPVLEPTGPLHTQFGYHIIKVLYRN

MD5 = f9de714674d1b64ac6831b260f357baa


  DNA Sequence

>fig|1125636.3.peg.4314 Peptidyl-prolyl cis-trans isomerase PpiC (EC 5.2.1.8)
atggcaaaaacagcagcagcactgcatatccttgtaaaagaagagaaactggctctggat
cttctcgagcagattaagaacggtgccgatttcggcaagctggcgaagaaacactccatt
tgcccatcaggcaaacgcggcggtgatttaggtgaattccgccagggtcagatggttccg
gcgttcgataaagttgtgttctcttgtccggtactggagccgaccggcccgctgcacacc
cagttcggttaccacatcattaaggtgctgtaccgcaactaa


  DNA with Flanking Sequence

>fig|1125636.3.peg.4314 Peptidyl-prolyl cis-trans isomerase PpiC (EC 5.2.1.8)
tcaacggaaaaattaatggcaacgcatgtatcgtcgttccattatcaaccactcgcgatc
atgacaagttaaatcgtggaatgcatgttgaaatagccagtaatgttatcaatgtcctgc
aattctttgatcagcagattcgttgggccaaagccgacctggtacaacaagtcagtcgaa
accgattaaatagagcaaggacttacagagggtatcttaatcaatgtttgccacatgagt
tggttgcagacatacagagggcggtcatcaagtcaatcaatgccatatcgctcataaatt
gacaataaaataaccatccccgataatgactttgtagcccatagaggccctaagttttct
ccccttgagggacctgcgaagcccggattttccgggcttttgccatatatgtaccagccc
ctccctgactgacaattacgttagcatctgcggatcatgctaaaatcgccgcctgacaat
tattcactcaaggcacgatcatggcaaaaacagcagcagcactgcatatccttgtaaaag
aagagaaactggctctggatcttctcgagcagattaagaacggtgccgatttcggcaagc
tggcgaagaaacactccatttgcccatcaggcaaacgcggcggtgatttaggtgaattcc
gccagggtcagatggttccggcgttcgataaagttgtgttctcttgtccggtactggagc
cgaccggcccgctgcacacccagttcggttaccacatcattaaggtgctgtaccgcaact
aatagcaaggccttctccaggagaaggccttgagtgttttctccctctccctgtgggaga
gggtcggggtgagggcatcagcgcgcacttaacccgcaacagcaatacgtttcatatctg
tcatatagccgcgcagtttcttacctacctgctcaatcgcatggctgcgaatcgcttcgt
tcacatcacgcagttgcgcgttatctaccgcgccttccggaatagctttacccaagtcgc
ccggttgcagctctgccataaacggtttcagcaacggcacacaagcgtaagagaacagat
agttaccgtactcagcggtatcagagataaccacgttcatttcgtacagacgcttacggg
cgatggtgttggcaatcagcggcagctcgtgcagtgattcataatatgcagactcttcaa
tgatgccggaatcgaccatggtttcgaacgccagttcaacgcccgctttcaccatcgcga
tcatcagtacgcctttatcgaa


  Assignments for Essentially Identical Proteins

No essentially identical proteins found

  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value
evidence_code dlit(8163020);gjo


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search