The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|1125636.3.peg.4306: Escherichia coli 2854350

This feature in The SEED Viewer

NCBI Taxonomy Id: 1125636

Current Assignment: Acetolactate synthase large subunit (EC 2.2.1.6)
Turn Off Function Translation



Context on contig APZL01000139 from base 87 to 11209 (11123 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
rna.107 87 206 120 +           5S RNA  
rna.108 259 332 74 + 52         tRNA-Asp-GTC  
rna.109 344 416 73 + 11         tRNA-Trp-CCA  
4303 1354 515 840 - 98         HTH-type transcriptional regulator hdfR locus|EC2854350_4132, protein_id|END37814.1, gi|477055050
4304 1473 1811 339 + 118         UPF0438 protein YifE locus|EC2854350_4133, protein_id|END37815.1, gi|477055051
4305 3356 1836 1521 - 24         MG(2+) CHELATASE FAMILY PROTEIN / ComM-related protein locus|EC2854350_4134, protein_id|END37816.1, gi|477055052
4306 3947 5593 1647 + 590     1: 1   Acetolactate synthase large subunit (EC 2.2.1.6) locus|EC2854350_4135, protein_id|END37817.1, gi|477055053
4307 5590 5853 264 + -4     1: 1 dlit(3550695) Acetolactate synthase small subunit (EC 2.2.1.6) gene_name|ilvM, locus|EC2854350_4136, protein_id|END37818.1, gi|477055054
4308 5873 6802 930 + 19     2: 2 1 dlit(9163511)
dlit(3550695)
dlit(3897211)
dlit(3069843)
Branched-chain amino acid aminotransferase (EC 2.6.1.42) gene_name|ilvE, locus|EC2854350_4137, protein_id|END37819.1, gi|477055055
4309 6867 8717 1851 + 64     1: 1   Dihydroxy-acid dehydratase (EC 4.2.1.9) gene_name|ilvD, locus|EC2854350_4138, protein_id|END37820.1, gi|477055056
4310 8720 10264 1545 + 2     1: 1   Threonine dehydratase biosynthetic (EC 4.3.1.19) locus|EC2854350_4139, protein_id|END37821.1, gi|477055057
4311 11209 10316 894 - 51         Transcriptional regulator IlvY, LysR family locus|EC2854350_4140, protein_id|END37822.1, gi|477055058

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
Leucine,_Isoleucine,_and_Valine_biosynthesis_PanGenomes Acharya_Geeta_user Acetolactate synthase large subunit (EC 2.2.1.6)


  Protein Sequence

>fig|1125636.3.peg.4306 Acetolactate synthase large subunit (EC 2.2.1.6)
MNGAQWVVHALRAQGVNTVFGYPGGAIMPVYDALYDGGVEHLLCRHEQGAAMAAIGYARA
TGKTGVCIATSGPGATNLITGLADALLDSIPVVAITGQVSAPFIGTDAFQEVDVLGLSLA
CTKHSFLVQSLEELPRIMAAAFDVASSGRPGPVLVDIPKDIQLASGDLEPWFTTVENEVT
FPHAEVEQARQMLAKAQKPMLYVGGGVGMAQAVPALREFLATTKMPATCTLKGLGAVEAD
YPYYLGMLGMHGTKAANFAVQECDLLIAVGARFDDRVTGKLNTFAPHASVIHMDIDPAEM
NKLRQAHVALQGDLNALLPALQQPLNINDWQLHCAQLRDEHAWRYDHPGDAIYAPLLLKQ
LSDRKPADCVVTTDVGQHQMWAAQHIAHTRPENFITSSGLGTMGFGLPAAVGAQVARPND
TVVCISGDGSFMMNVQELGTVKRKQLPLKIVLLDNQRLGMVRQWQQLFFQERYSETTLTD
NPDFLMLASAFGIPGQHITRKDQVEAALDTMLNSDGPYLLHVSIDELENVWPLVPPGASN
SEMLEKLS

MD5 = 1aa92a5c134ed8c1049163e7ee88c49a


  DNA Sequence

>fig|1125636.3.peg.4306 Acetolactate synthase large subunit (EC 2.2.1.6)
atgaatggcgcacagtgggtggtacatgcgttgcgggcacagggtgtgaacaccgttttc
ggttatccgggtggcgcaattatgccggtttacgatgcattgtatgacggcggcgtggag
cacttgctatgccgacatgagcagggtgcggcaatggcggctatcggttatgcccgtgct
accggcaaaactggcgtatgtatcgccacgtctggtccgggcgcaaccaacctgataacc
gggcttgcggacgcactgttagattccatccctgtcgttgccatcaccggtcaagtgtcc
gcaccttttatcggcaccgacgcatttcaggaagtggatgtcctgggattgtcgttagcc
tgtaccaagcacagctttctggtgcagtcgctggaagagttgccgcgcatcatggctgca
gcattcgacgttgccagctcaggtcgtcctggtccggttctggtcgatatcccaaaagat
atccagctagccagcggtgacctggaaccgtggttcaccaccgttgaaaacgaagtgact
ttcccacatgccgaagttgagcaagcgcgccagatgctggcaaaagcgcaaaaaccgatg
ctgtacgttggtggtggcgtgggtatggcgcaggcagttcctgctttacgagaatttctc
gctaccacaaaaatgcctgccacctgcacgctgaaagggctgggcgcagttgaagcagat
tatccgtactatctgggcatgctgggaatgcatggcaccaaagcggcgaacttcgcggtg
caggagtgcgacttgctgatcgccgtgggtgcacgttttgatgaccgggtgaccggcaaa
ctgaacaccttcgcaccacacgccagtgttatccatatggatatcgacccggcagaaatg
aacaagctgcgtcaggcacatgtggcattacaaggtgatttaaatgctctgttaccagca
ttacagcagccgttaaatatcaatgactggcagctacactgcgcgcagctgcgtgatgaa
catgcctggcgttacgaccatcccggtgacgctatctacgcgccattgttgttaaaacaa
ctgtcggatcgtaaacctgcggattgcgtcgtgaccacagatgtggggcagcaccagatg
tgggctgcgcagcacatcgcccatactcgcccggaaaatttcatcacctccagcggctta
ggcaccatgggtttcggtttaccggcggcggttggcgcgcaagtcgcgcgaccgaacgat
accgtcgtctgtatctccggtgacggctctttcatgatgaatgtacaagagctgggcacc
gtaaaacgtaagcagttaccgttgaaaatcgtcttactcgataaccaacggttagggatg
gttcgacaatggcagcaactgtttttccaggaacgatatagcgaaaccacccttaccgat
aaccccgattttctcatgttagccagcgccttcggcatccctggccaacacatcacccgt
aaagaccaggttgaagcggcactcgacaccatgctgaacagtgatgggccatacctgctt
catgtctcaatcgacgaacttgagaacgtctggccgctggtgccgcctggtgccagtaat
tcagaaatgttggagaaattatcatga


  DNA with Flanking Sequence

>fig|1125636.3.peg.4306 Acetolactate synthase large subunit (EC 2.2.1.6)
gtgcaagtgaagttgagttgttctggcggtggaatgatgctcgcaaaaatgcagcggaca
aaggatgaactacgaggaagggaacaacatttatactgaaattgaatttttttcactcac
tattttctttttaaaaaacaacaatttctattgaaattattaaagccatcataaaaatag
gcccaaaaatatcttgtgctattcgcaaaatctatggtaactctttaggcattccttcga
acaagatgcaagaaaagacaaaatgacagcccttctacgagtgattagcctggtcgtgat
tagcgtggtggtgattattatcccaccgtgcggggctgcacttggacgaggaaaggctta
gagatcaagccttaacgaactaagacccccgcaccgaaaggtccgggggttttttttgac
cttaaaaacataaccgaggagcagacaatgaataacagcacaaaattctgtttctcaaga
ttcaggacggggaactaactatgaatggcgcacagtgggtggtacatgcgttgcgggcac
agggtgtgaacaccgttttcggttatccgggtggcgcaattatgccggtttacgatgcat
tgtatgacggcggcgtggagcacttgctatgccgacatgagcagggtgcggcaatggcgg
ctatcggttatgcccgtgctaccggcaaaactggcgtatgtatcgccacgtctggtccgg
gcgcaaccaacctgataaccgggcttgcggacgcactgttagattccatccctgtcgttg
ccatcaccggtcaagtgtccgcaccttttatcggcaccgacgcatttcaggaagtggatg
tcctgggattgtcgttagcctgtaccaagcacagctttctggtgcagtcgctggaagagt
tgccgcgcatcatggctgcagcattcgacgttgccagctcaggtcgtcctggtccggttc
tggtcgatatcccaaaagatatccagctagccagcggtgacctggaaccgtggttcacca
ccgttgaaaacgaagtgactttcccacatgccgaagttgagcaagcgcgccagatgctgg
caaaagcgcaaaaaccgatgctgtacgttggtggtggcgtgggtatggcgcaggcagttc
ctgctttacgagaatttctcgctaccacaaaaatgcctgccacctgcacgctgaaagggc
tgggcgcagttgaagcagattatccgtactatctgggcatgctgggaatgcatggcacca
aagcggcgaacttcgcggtgcaggagtgcgacttgctgatcgccgtgggtgcacgttttg
atgaccgggtgaccggcaaactgaacaccttcgcaccacacgccagtgttatccatatgg
atatcgacccggcagaaatgaacaagctgcgtcaggcacatgtggcattacaaggtgatt
taaatgctctgttaccagcattacagcagccgttaaatatcaatgactggcagctacact
gcgcgcagctgcgtgatgaacatgcctggcgttacgaccatcccggtgacgctatctacg
cgccattgttgttaaaacaactgtcggatcgtaaacctgcggattgcgtcgtgaccacag
atgtggggcagcaccagatgtgggctgcgcagcacatcgcccatactcgcccggaaaatt
tcatcacctccagcggcttaggcaccatgggtttcggtttaccggcggcggttggcgcgc
aagtcgcgcgaccgaacgataccgtcgtctgtatctccggtgacggctctttcatgatga
atgtacaagagctgggcaccgtaaaacgtaagcagttaccgttgaaaatcgtcttactcg
ataaccaacggttagggatggttcgacaatggcagcaactgtttttccaggaacgatata
gcgaaaccacccttaccgataaccccgattttctcatgttagccagcgccttcggcatcc
ctggccaacacatcacccgtaaagaccaggttgaagcggcactcgacaccatgctgaaca
gtgatgggccatacctgcttcatgtctcaatcgacgaacttgagaacgtctggccgctgg
tgccgcctggtgccagtaattcagaaatgttggagaaattatcatgatgcaacatcaggt
caatgtatcggctcgcttcaatccggaaaccttagaacgtgttttacgcgtggtgcgtca
tcgtggtttccacgtctgctcaatgaatatggccgccgccagcgatgcacaaaatataaa
tatcgaattgaccgttgccagcccacggtcggtcgacttactgtttagtcagttaaataa
actggtggacgtcgcacacgttgccatctgccagagcacaaccacatcacaacaaatccg
cgcctgagcgcaaaaggaatataaaaatgaccacgaagaaagctgattacatttggttca
atggggagatggttcgctgggaagacgcgaaggtgcatgtgatgtcgcacgcgctgcact
atggcacctcggtttttgaaggcatccgttgctacgactcacacaaaggaccggttgtat
tccgccatcgtgagcatatgcagcgtctgcatgactccgccaaaatctatcgcttcccgg
tttcaca


  Assignments for Essentially Identical Proteins

No essentially identical proteins found

  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search