The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|1116221.3.peg.2742: Staphylococcus aureus subsp. aureus VRS8

This feature in The SEED Viewer

NCBI Taxonomy Id: 1116221

Current Assignment: Phage protein
Translate Function Assignments



Context on contig AHBR01000058 from base 55 to 3612 (3558 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
2736 261 55 207 -           Phage protein locus|MQO_02755, protein_id|EIK18895.1, gi|387731617
2737 517 275 243 - 13         hypothetical protein locus|MQO_02756, protein_id|EIK18896.1, gi|387731618
2738 777 523 255 - 5         Phage protein locus|MQO_02757, protein_id|EIK18897.1, gi|387731619
2739 1394 777 618 - -1         ORF022 locus|MQO_02758, protein_id|EIK18898.1, gi|387731620
2740 1580 1395 186 - 0         Hypothetical protein, PV83 orf23 homolog [SA bacteriophages 11, Mu50B] locus|MQO_02759, protein_id|EIK18899.1, gi|387731621
2741 1987 1580 408 - -1         Phage Holliday junction resolvase locus|MQO_02760, protein_id|EIK18900.1, gi|387731622
2742 2218 1997 222 - 9         Phage protein locus|MQO_02761, protein_id|EIK18901.1, gi|387731623
2743 2389 2231 159 - 12         Phage protein locus|MQO_02762, protein_id|EIK18902.1, gi|387731624
2744 3162 2383 780 - -7         DNA replication protein DnaC locus|MQO_02763, protein_id|EIK18903.1, gi|387731625
2745 3612 3172 441 - 9         FIG01108033: hypothetical protein locus|MQO_02764, protein_id|EIK18904.1, gi|387731626

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|1116221.3.peg.2742 Phage protein
MPKEKYYLYREDGTEDIKVIKYKDNANEVYSLTGAHFSDEKKIMTDSDLKRFKGAHGLLY
EQELGLQATIFDI

MD5 = 3179306b60a1e9b4a503090acd534d38


  DNA Sequence

>fig|1116221.3.peg.2742 Phage protein
atgccgaaagaaaaatattacttataccgagaagatggcacggaagatatcaaagtcatc
aagtataaagacaacgcaaatgaagtttattcgcttacaggagcccatttcagcgacgaa
aagaaaattatgactgatagtgacctaaaacgattcaaaggcgctcacgggcttctatat
gagcaagaactagggttacaagcaacgatatttgatatttag


  DNA with Flanking Sequence

>fig|1116221.3.peg.2742 Phage protein
gttgcttttatgcacataccaatgttgatggatcgtatcaaagcgacatacaacaaaaat
gcagttgaaactacagacgagctagtcagattgctaagtgatattgatttacttgtacta
gatgatatgggtgtagaaaacacagagcacactttaaataaacttttcagcattgttgat
aacagagtaggtaaaaacaacatctttacaactaactttagtgataaagaactaaatcaa
aatatgaactggcaacgtatcaattcaagaatgaaacacaatgcgagaaaagtaagagta
atcggagacgatttcagggagcgagatgcatggtaaccaaagaatttttaaaaactaaac
ttgagtgttcagatatgtacgctcagaaactcatagacgaggcacagggcgatgaaaata
ggttgtacgacctatttatccaaaaacttgcagaacgtcatacacgccccgctatcgtcg
aatattaaggagtgttaaaaatgccgaaagaaaaatattacttataccgagaagatggca
cggaagatatcaaagtcatcaagtataaagacaacgcaaatgaagtttattcgcttacag
gagcccatttcagcgacgaaaagaaaattatgactgatagtgacctaaaacgattcaaag
gcgctcacgggcttctatatgagcaagaactagggttacaagcaacgatatttgatattt
agaggtggcacatggaaatagaaattaaatttaacgaaacgtttgaggcacctatgggct
cgcctcgtccacgctttcgtaatacaggtagatttgttcaaacttacatgcctacgtctt
atacaaagcataaagcgtatatacaaggacaaatgcctaagttgaatctagaacatgcac
taaaaatcgaatcagacttttactttccattgcttaaatcatggtcgaagaaaaagaaaa
gtgaaatggttggacagtataaagtgactaagccggatatcgataacttaattaaaacag
tattagacgcatgtaatggtcatgtatggaaagacgataaccaaattacagaaataacta
gctcaaagcgttatggactagaaccaaaaataatcatgcgagttgaggaagtgatctaat
gcaacaacaagcatatataaacgcaacgattgatataagaatacctacagaagttgaata
tcagcattttgatgatgtggat


  Assignments for Essentially Identical Proteins

No essentially identical proteins found

  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search