The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|1116050.3.peg.773: Escherichia coli P0299917.4

This feature in The SEED Viewer

NCBI Taxonomy Id: 1116050

Current Assignment: Succinyl-CoA ligase [ADP-forming] beta chain (EC 6.2.1.5)
Translate Function Assignments



Context on contig APYN01000017 from base 19476 to 32117 (12642 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
770 19476 20192 717 +       2: 1 2   Succinate dehydrogenase iron-sulfur protein (EC 1.3.99.1) gene_name|sdhB, locus|ECP02999174_0782, protein_id|ENC59043.1, gi|476971624
771 20393 23194 2802 + 200     1: 1 dlit(6376123) 2-oxoglutarate dehydrogenase E1 component (EC 1.2.4.2) gene_name|sucA, locus|ECP02999174_0783, protein_id|ENC59044.1, gi|476971625
772 23209 24426 1218 + 14     2: 1 3   Dihydrolipoamide succinyltransferase component (E2) of 2-oxoglutarate dehydrogenase complex (EC 2.3.1.61) gene_name|sucB, locus|ECP02999174_0784, protein_id|ENC59045.1, gi|476971626
773 24520 25686 1167 + 93     1: 1 dlit(3002435) Succinyl-CoA ligase [ADP-forming] beta chain (EC 6.2.1.5) gene_name|sucC, locus|ECP02999174_0785, protein_id|ENC59046.1, gi|476971627
774 25686 26555 870 + -1     1: 1 dlit(3002435) Succinyl-CoA ligase [ADP-forming] alpha chain (EC 6.2.1.5) gene_name|sucD, locus|ECP02999174_0786, protein_id|ENC59047.1, gi|476971628
775 27381 26659 723 - 103         Transcriptional regulator of succinyl CoA synthetase operon gene_name|mngR, locus|ECP02999174_0787, protein_id|ENC59048.1, gi|476971629
776 27550 29466 1917 + 168         PTS system HrsA EIIA component / PTS system HrsA EIIB component / PTS system HrsA permease IIC component gene_name|hrsA, locus|ECP02999174_0788, protein_id|ENC59049.1, gi|476971630
777 29484 32117 2634 + 17         Alpha-mannosidase (EC 3.2.1.24) gene_name|mngB, locus|ECP02999174_0789, protein_id|ENC59050.1, gi|476971631

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
TCA_and_Glyoxylate_pathway_PanGenomes OKPALA_EMMANUEL_user Succinyl-CoA ligase [ADP-forming] beta chain (EC 6.2.1.5)


  Protein Sequence

>fig|1116050.3.peg.773 Succinyl-CoA ligase [ADP-forming] beta chain (EC 6.2.1.5)
MNLHEYQAKQLFARYGLPAPVGYACTTPREAEEAASKIGAGPWVVKCQVHAGGRGKAGGV
KVVNSKEDIRAFAENWLGKRLVTYQTDANGQPVNQILVEAATDIAKELYLGAVVDRSSRR
VVFMASTEGGVEIEKVAEETPHLIHKVALDPLTGPMPYQGRELAFKLGLEGKLVQQFTKI
FMGLATIFLERDLALIEINPLVITKQGDLICLDGKLGADGNALFRQPDLREMRDQSQEDP
REAQAAQWELNYVALDGNIGCMVNGAGLAMGTMDIVKLHGGEPANFLDVGGGATKERVTE
AFKIILSDDKVKAVLVNIFGGIVRCDLIADGIIGAVAEVGVNVPVVVRLEGNNAELGAKK
LADSGLNIIAAKGLTDAAQQVVAAVEGK

MD5 = d3e359441fbb6d15ad5d4ade4c910750


  DNA Sequence

>fig|1116050.3.peg.773 Succinyl-CoA ligase [ADP-forming] beta chain (EC 6.2.1.5)
atgaacttacatgaatatcaggcaaaacaactttttgcccgctatggcttaccagcaccg
gtgggttatgcctgtactactccgcgcgaagcagaagaagccgcttcaaaaatcggtgcc
ggcccgtgggtagtgaaatgtcaggttcacgctggtggccgcggtaaagcgggcggtgtg
aaagttgtaaacagcaaagaagacatccgtgcttttgcagaaaactggctcggcaagcgt
ctggtaacgtatcaaacagatgccaatggccaaccggttaaccagattctggttgaagca
gcgaccgatatcgctaaagagctgtatctcggtgccgttgtagaccgtagttcccgtcgc
gtggtctttatggcctccaccgaaggcggcgtggaaatcgaaaaagtggcggaagaaact
ccgcacctgatccataaagttgcgcttgatccgctgacaggcccgatgccgtatcaggga
cgcgagctggcgttcaaactgggtctggaaggtaaactggttcagcagttcaccaaaatc
ttcatgggcctggcgaccattttcctggagcgcgacctggcgttgatcgaaatcaacccg
ctggtcatcaccaaacagggcgatctgatttgcctcgacggcaaactgggcgctgacggc
aacgcactgttccgccagcctgatctgcgcgaaatgcgtgaccagtcgcaggaagatccg
cgtgaagcacaggctgcacagtgggaactgaactacgttgcgctggacggtaacatcggt
tgtatggttaacggcgcaggtctggcgatgggtacgatggacatcgttaaactgcacggc
ggcgaaccggctaacttccttgacgttggcggcggcgcaaccaaagaacgtgtaaccgaa
gcgttcaaaatcatcctctctgacgacaaagtgaaagccgttctggttaacatcttcggc
ggtatcgttcgttgcgacctgatcgctgacggtatcatcggcgcggtagcagaagtgggt
gttaacgtaccggtcgtggtacgtctggaaggtaacaacgccgaactcggcgcgaagaaa
ctggctgacagcggcctgaatattattgcagcaaaaggtctgacggatgcagctcagcag
gttgttgccgcagtggaggggaaataa


  DNA with Flanking Sequence

>fig|1116050.3.peg.773 Succinyl-CoA ligase [ADP-forming] beta chain (EC 6.2.1.5)
tggcggtttctacgccgcgcggcctggtgacaccggtactgcgtgatgtcgataccctcg
gcatggcagacatcgagaagaaaatcaaagagctggcagtcaaaggccgtgacggcaagc
tgaccgttgaagatctgaccggtggtaacttcaccatcaccaacggtggtgtgttcggtt
ccctgatgtctacgccgatcatcaccccgccgcagagcgcaattctgggtatgcacgcta
tcaaagatcgtccgatggcggtgaatggtcaggttgagatcctgccgatgatgtacctgg
cgctgtcctacgatcaccgtctgatcgatggtcgcgaatccgtgggcttcctggtaacga
tcaaagagttgctggaagatccgacgcgtctgctgctggacgtgtagtagtttaagcttc
acctgcactgtagaccgacgtggatagggtgtcggtctacggtttaaaagataacgatta
ctgaaggatggacagaacacatgaacttacatgaatatcaggcaaaacaactttttgccc
gctatggcttaccagcaccggtgggttatgcctgtactactccgcgcgaagcagaagaag
ccgcttcaaaaatcggtgccggcccgtgggtagtgaaatgtcaggttcacgctggtggcc
gcggtaaagcgggcggtgtgaaagttgtaaacagcaaagaagacatccgtgcttttgcag
aaaactggctcggcaagcgtctggtaacgtatcaaacagatgccaatggccaaccggtta
accagattctggttgaagcagcgaccgatatcgctaaagagctgtatctcggtgccgttg
tagaccgtagttcccgtcgcgtggtctttatggcctccaccgaaggcggcgtggaaatcg
aaaaagtggcggaagaaactccgcacctgatccataaagttgcgcttgatccgctgacag
gcccgatgccgtatcagggacgcgagctggcgttcaaactgggtctggaaggtaaactgg
ttcagcagttcaccaaaatcttcatgggcctggcgaccattttcctggagcgcgacctgg
cgttgatcgaaatcaacccgctggtcatcaccaaacagggcgatctgatttgcctcgacg
gcaaactgggcgctgacggcaacgcactgttccgccagcctgatctgcgcgaaatgcgtg
accagtcgcaggaagatccgcgtgaagcacaggctgcacagtgggaactgaactacgttg
cgctggacggtaacatcggttgtatggttaacggcgcaggtctggcgatgggtacgatgg
acatcgttaaactgcacggcggcgaaccggctaacttccttgacgttggcggcggcgcaa
ccaaagaacgtgtaaccgaagcgttcaaaatcatcctctctgacgacaaagtgaaagccg
ttctggttaacatcttcggcggtatcgttcgttgcgacctgatcgctgacggtatcatcg
gcgcggtagcagaagtgggtgttaacgtaccggtcgtggtacgtctggaaggtaacaacg
ccgaactcggcgcgaagaaactggctgacagcggcctgaatattattgcagcaaaaggtc
tgacggatgcagctcagcaggttgttgccgcagtggaggggaaataatgtccattttaat
tgataaaaacaccaaggttatctgccagggctttactggtagccaggggactttccactc
agaacaggccattgcatacggcactaaaatggttggcggcgtaaccccaggtaaaggcgg
tactacccacctcggcctgccggtgttcaacaccgtgcgtgaagctgttgctgctactgg
cgctaccgcttctgttatctacgtaccagcaccgttctgcaaagactccattctggaagc
tattgatgcaggcatcaaactgattatcaccatcactgaaggcatcccgacgctggatat
gctgactgtgaaagtgaaactggacgaagccggcgttcgtatgatcggcccgaactgccc
gggcgttatcactccgggtgaatgcaaaatcggtatccagccgggtcacattcacaaacc
gggtaaagtgggtatcgtttcccgttccggtacactgacctatgaagcggttaaacagac
cacggat


  Assignments for Essentially Identical Proteins

No essentially identical proteins found

  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value
evidence_code dlit(3002435);gjo


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search