The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|1116050.3.peg.5010: Escherichia coli P0299917.4

This feature in The SEED Viewer

NCBI Taxonomy Id: 1116050

Current Assignment: Aspartokinase (EC 2.7.2.4) / Homoserine dehydrogenase (EC 1.1.1.3)
Translate Function Assignments



Context on contig APYN01000091 from base 21642 to 32395 (10754 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
5006 21642 23066 1425 +           Two-component response regulator CreC gene_name|creC, locus|ECP02999174_5105, protein_id|ENC51386.1, gi|476963556
5007 23124 24476 1353 + 57         Inner membrane protein CreD gene_name|creD, locus|ECP02999174_5106, protein_id|ENC51387.1, gi|476963557
5008 25252 24536 717 - 59       dlit(7565118) Aerobic respiration control response regulator ArcA locus|ECP02999174_5107, protein_id|ENC51388.1, gi|476963558
5009 25888 26574 687 + 635         RNA methyltransferase, TrmH family, group 1 locus|ECP02999174_5108, protein_id|ENC51389.1, gi|476963559
5010 26934 29396 2463 + 359     3: 1 3 4   Aspartokinase (EC 2.7.2.4) / Homoserine dehydrogenase (EC 1.1.1.3) gene_name|thrA, locus|ECP02999174_5109, protein_id|ENC51390.1, gi|476963560
5011 29398 30330 933 + 1     4: 1 5 7 6   Homoserine kinase (EC 2.7.1.39) gene_name|thrB, locus|ECP02999174_5110, protein_id|ENC51391.1, gi|476963561
5012 30331 31617 1287 + 0     2: 1 2   Threonine synthase (EC 4.2.3.1) gene_name|thrC, locus|ECP02999174_5111, protein_id|ENC51392.1, gi|476963562
5013 32395 31907 489 - 289         hypothetical protein  

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
Lysine_biosynthesis_PanGenomes Acharya_Geeta_user Aspartokinase (EC 2.7.2.4)
Methionine_biosynthesis_PanGenomes Acharya_Geeta_user Aspartokinase (EC 2.7.2.4)
Methionine_biosynthesis_PanGenomes Acharya_Geeta_user Homoserine dehydrogenase (EC 1.1.1.3)
Threonine_biosynthesis_PanGenomes Acharya_Geeta_user Aspartokinase (EC 2.7.2.4)
Threonine_biosynthesis_PanGenomes Acharya_Geeta_user Homoserine dehydrogenase (EC 1.1.1.3)


  Protein Sequence

>fig|1116050.3.peg.5010 Aspartokinase (EC 2.7.2.4) / Homoserine dehydrogenase (EC 1.1.1.3)
MRVLKFGGTSVANAERFLRVADILESNARQGQVATVLSAPAKITNHLVAMIEKTISGQDA
LPNISDAERIFAELLTGLAAAQPGFPLAQLKTFVDQEFAQIKHVLHGISLLGQCPDSINA
ALICRGEKMSIAIMAGVLEARGHNVTVIDPVEKLLAVGHYLESTVDIAESTRRIAASRIP
ADHMVLMAGFTAGNEKGELVVLGRNGSDYSAAVLAACLRADCCEIWTDVDGVYTCDPRQV
PDARLLKSMSYQEAMELSYFGAKVLHPRTITPIAQFQIPCLIKNTGNPQAPGTLIGASRD
EDELPVKGISNLNNMAMFSVSGPGMKGMVGMAARVFAAMSRARISVVLITQSSSEYSISF
CVPQSDCVRAERAMQEEFYLELKEGLLEPLAVTERLAIISVVGDGMRTLRGISAKFFAAL
ARANINIVAIAQGSSERSISVVVNNDDATTGVRVTHQMLFNTDQVIEVFVIGVGGVGGAL
LEQLKRQQSWLKNKHIDLRVCGVANSKALLTNVHGLNLENWQEELAQAKEPFNLGRLIRL
VKEYHLLNPVIVDCTSSQAVADQYADFLREGFHVVTPNKKANPSSMDYYHLLRHAAEKSR
RKFLYDTNVGAGLPVIENLQNLLNAGDELMKFSGILSGSLSYIFGKLDEGMSFSEATTLA
REMGYTEPDPRDDLSGMDVARKLLILARETGRELELADIEIEPVLPAEFNAEGDVAAFMA
NLSQLDDLFAARVAKARDEGKVLRYVGNIDEDGACRVKIAEVDGNDPLFKVKNGENALAF
YSHYYQPLPLVLRGYGAGNDVTAAGVFADLLRTLSWKLGV

MD5 = 6ec294e3ae42cd4f9e5c8a350cc1bb75


  DNA Sequence

>fig|1116050.3.peg.5010 Aspartokinase (EC 2.7.2.4) / Homoserine dehydrogenase (EC 1.1.1.3)
atgcgagtgttgaagttcggcggtacatcagtggcaaatgcagaacgttttctgcgtgtt
gccgatattctggaaagcaatgccaggcaggggcaggtggccaccgtcctctctgccccc
gccaaaatcaccaaccacctggtggcgatgattgaaaaaaccattagcggccaggatgct
ttacccaatatcagcgatgccgaacgtatttttgccgaacttttgacgggactcgccgcc
gcccagccggggttcccgctggcgcaattgaaaactttcgtcgatcaggaatttgcccaa
ataaaacatgtcctgcatggcattagtttgttggggcagtgcccggatagcatcaacgct
gcgctgatttgccgtggcgagaaaatgtcgatcgccattatggccggcgtgttagaagcg
cgtggtcacaacgttaccgttatcgatccggtcgaaaaactgctggcagtggggcattac
ctcgaatctaccgtcgatattgctgagtccacccgccgtattgcggcaagccgcattccg
gctgatcacatggtgttgatggcaggtttcaccgccggtaatgaaaaaggcgaactggtg
gtacttggacgcaacggttccgactactccgcggcggtgctggctgcctgtttacgcgcc
gattgttgcgagatttggacggacgttgacggggtctatacctgcgacccgcgtcaggtg
cccgatgcgaggttgttgaagtcgatgtcctaccaggaagcgatggagctttcctacttc
ggcgctaaagttcttcacccccgcaccattacccccatcgcccagttccagatcccttgc
ctgattaaaaataccggaaatcctcaagcaccaggtacgctcattggtgccagtcgtgat
gaagacgaattaccggtcaagggcatttccaatctgaataacatggcaatgttcagcgtt
tccggcccggggatgaaaggaatggtcggcatggcggcgcgcgtctttgccgcgatgtca
cgcgcccgtatttccgtggtgctgattacgcaatcatcttccgaatacagtatcagtttc
tgcgttccgcaaagcgactgtgtgcgggctgaacgggcaatgcaggaagagttctacctg
gaactgaaagaaggcttactggagccgctggcggtgacggaacggctggccattatctcg
gtggtaggtgatggtatgcgcaccttgcgtgggatctcggcgaaattctttgccgcgctg
gcccgcgccaatatcaacattgtcgccattgctcagggatcttctgaacgctcaatctct
gtcgtggtaaataacgatgatgcgaccactggcgtgcgcgttactcatcagatgctgttc
aataccgatcaggttatcgaagtgtttgtgattggcgtcggtggcgttggcggtgcgctg
ctggagcaactgaagcgtcaacaaagctggctgaagaataaacatatcgacttacgtgtc
tgcggtgttgccaactcgaaggcactgctcaccaatgtgcatggcctaaatctggaaaac
tggcaggaagaactggcgcaagccaaagagccgtttaatctcgggcgcttaattcgcctc
gtgaaagaatatcatctgctgaacccggtcattgttgactgcacctccagccaggcagtg
gcggatcaatatgccgacttcttgcgcgaaggtttccacgttgtcacgccgaacaaaaag
gccaacccctcgtcgatggattactaccatctgttgcgtcatgcggcggaaaaatcgcgg
cgtaaattcctctatgacaccaacgttggggctggattaccggttattgagaacctgcaa
aatctgctcaatgctggtgatgaattgatgaagttctccggcattctttcaggttcgctt
tcttatatcttcggcaagttagacgaaggcatgagtttctccgaggcgactactctggcg
cgggaaatgggttataccgaaccggatccgcgagatgatctttctggtatggatgtagcg
cgtaagctattgattctcgctcgtgaaacgggacgtgaactggagctggcggatattgaa
attgaacctgtgctgcccgcagagtttaacgctgagggtgatgttgccgcttttatggcg
aatctgtcacagctcgacgatctctttgccgcgcgcgtggcgaaggcccgtgatgaagga
aaagttttgcgctatgttggcaatattgatgaagatggtgcctgccgcgtgaagattgcc
gaagtggatggtaatgatccgctgttcaaagtgaaaaatggcgaaaacgccctggccttt
tatagccactattatcagccgctgccgttggtgctgcgcggatatggtgcgggcaatgac
gttacagctgccggtgtctttgccgatctgctacgtaccctctcatggaagttaggagtc
tga


  DNA with Flanking Sequence

>fig|1116050.3.peg.5010 Aspartokinase (EC 2.7.2.4) / Homoserine dehydrogenase (EC 1.1.1.3)
gcattgctgacgactctggcagtggcagatgacataaaactggtcgactggttacaacaa
cgcctggggcttttagagcaacgagacacggcaatgttgcaccgtttgctgcatgatatt
gaaaaaaatatcaccaaataaaaaacgccttagtaagtatttttcagcttttcattctga
ctgcaacgggcaatatgtctctgtgtggattaaaaaaagagtgtctgatagcagcttctg
aactggttacctgccgtgagtaaattaaaattttattgacttaggtcactaaatacttta
accaatataggcatagcgcacagacagataaaaattacagagtacacaacatccatgaaa
cgcattagcaccaccattaccaccaccatcaccattaccacaggtaacggtgcgggctga
cgcgtacaggaaacacagaaaaaagcccgcacctgacagtgcgggcttttttttcgacca
aaggtaacgaggtaacaaccatgcgagtgttgaagttcggcggtacatcagtggcaaatg
cagaacgttttctgcgtgttgccgatattctggaaagcaatgccaggcaggggcaggtgg
ccaccgtcctctctgcccccgccaaaatcaccaaccacctggtggcgatgattgaaaaaa
ccattagcggccaggatgctttacccaatatcagcgatgccgaacgtatttttgccgaac
ttttgacgggactcgccgccgcccagccggggttcccgctggcgcaattgaaaactttcg
tcgatcaggaatttgcccaaataaaacatgtcctgcatggcattagtttgttggggcagt
gcccggatagcatcaacgctgcgctgatttgccgtggcgagaaaatgtcgatcgccatta
tggccggcgtgttagaagcgcgtggtcacaacgttaccgttatcgatccggtcgaaaaac
tgctggcagtggggcattacctcgaatctaccgtcgatattgctgagtccacccgccgta
ttgcggcaagccgcattccggctgatcacatggtgttgatggcaggtttcaccgccggta
atgaaaaaggcgaactggtggtacttggacgcaacggttccgactactccgcggcggtgc
tggctgcctgtttacgcgccgattgttgcgagatttggacggacgttgacggggtctata
cctgcgacccgcgtcaggtgcccgatgcgaggttgttgaagtcgatgtcctaccaggaag
cgatggagctttcctacttcggcgctaaagttcttcacccccgcaccattacccccatcg
cccagttccagatcccttgcctgattaaaaataccggaaatcctcaagcaccaggtacgc
tcattggtgccagtcgtgatgaagacgaattaccggtcaagggcatttccaatctgaata
acatggcaatgttcagcgtttccggcccggggatgaaaggaatggtcggcatggcggcgc
gcgtctttgccgcgatgtcacgcgcccgtatttccgtggtgctgattacgcaatcatctt
ccgaatacagtatcagtttctgcgttccgcaaagcgactgtgtgcgggctgaacgggcaa
tgcaggaagagttctacctggaactgaaagaaggcttactggagccgctggcggtgacgg
aacggctggccattatctcggtggtaggtgatggtatgcgcaccttgcgtgggatctcgg
cgaaattctttgccgcgctggcccgcgccaatatcaacattgtcgccattgctcagggat
cttctgaacgctcaatctctgtcgtggtaaataacgatgatgcgaccactggcgtgcgcg
ttactcatcagatgctgttcaataccgatcaggttatcgaagtgtttgtgattggcgtcg
gtggcgttggcggtgcgctgctggagcaactgaagcgtcaacaaagctggctgaagaata
aacatatcgacttacgtgtctgcggtgttgccaactcgaaggcactgctcaccaatgtgc
atggcctaaatctggaaaactggcaggaagaactggcgcaagccaaagagccgtttaatc
tcgggcgcttaattcgcctcgtgaaagaatatcatctgctgaacccggtcattgttgact
gcacctccagccaggcagtggcggatcaatatgccgacttcttgcgcgaaggtttccacg
ttgtcacgccgaacaaaaaggccaacccctcgtcgatggattactaccatctgttgcgtc
atgcggcggaaaaatcgcggcgtaaattcctctatgacaccaacgttggggctggattac
cggttattgagaacctgcaaaatctgctcaatgctggtgatgaattgatgaagttctccg
gcattctttcaggttcgctttcttatatcttcggcaagttagacgaaggcatgagtttct
ccgaggcgactactctggcgcgggaaatgggttataccgaaccggatccgcgagatgatc
tttctggtatggatgtagcgcgtaagctattgattctcgctcgtgaaacgggacgtgaac
tggagctggcggatattgaaattgaacctgtgctgcccgcagagtttaacgctgagggtg
atgttgccgcttttatggcgaatctgtcacagctcgacgatctctttgccgcgcgcgtgg
cgaaggcccgtgatgaaggaaaagttttgcgctatgttggcaatattgatgaagatggtg
cctgccgcgtgaagattgccgaagtggatggtaatgatccgctgttcaaagtgaaaaatg
gcgaaaacgccctggccttttatagccactattatcagccgctgccgttggtgctgcgcg
gatatggtgcgggcaatgacgttacagctgccggtgtctttgccgatctgctacgtaccc
tctcatggaagttaggagtctgacatggttaaagtttatgccccggcttccagtgccaat
atgagcgtcgggtttgatgtgctcggggcggcggtgacacctgttgatggtgcattgctc
ggagatgtagtcacggttgaggcggcagagacattcagtctcaacaacctcggacgcttt
gccgataagctgccgtcagaaccacgggaaaatatcgtttatcagtgctgggagcgtttt
tgccaggagcttggcaagcaaattccagtggcgatgactctggaaaagaatatgccaatc
ggttcgggcttaggctccagcgcctgttcggtggtcgcggcgctgatggcgatgaatgaa
cactgtggcaagccgcttaatgacactcgtttgctggctttgatgggcgagctggaagga
cgaatctccggcagcattcattacgacaacgtggcaccgtgttttcttggtggtatgcag
ttgatgatcgaagaaaacgacatcatcagccagcaagtgccag


  Assignments for Essentially Identical Proteins

No essentially identical proteins found

  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search